(data stored in ACNUC7421 zone)

EMBL: CP000529.PE377

CP000529.PE377       Location/Qualifiers
FT   CDS_pept        378109..378603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35704"
FT                   /db_xref="GOA:A1VJ76"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ76"
FT                   /protein_id="ABM35704.1"
FT                   /translation="MASVQDRALKTIAAFEGLKGLAAIASGLGLLSLLHHDIRHLALEL
FT                   VGHFGLNPAQHFPSLFLHYVDLLNSTPVSTLMLLLCGYAALRLAEAYALWRERAWGALL
FT                   GALSGGIYIPFEWRHLLHRPSLISAGVLAVNVLIVVFLAYRLWRRRVAIRSSKNSIELW
FT                   G"
     atggcctcgg ttcaggaccg ggcgctcaaa accatcgccg cgtttgaagg gctaaagggc        60
     cttgccgcca tcgccagcgg cttggggctg ctgagcctgc tgcaccacga tatccggcat       120
     ctcgcgctgg agctggtcgg gcacttcggc ctcaatcccg cgcagcattt cccctcgctc       180
     tttttgcact acgttgacct gttgaacagc acgccggtca gcaccttgat gcttcttttg       240
     tgcggctatg cggcgctgcg cctggccgaa gcctacgccc tgtggcgcga acgcgcatgg       300
     ggcgcgctgc tgggcgcctt gtcgggcgga atctacattc cctttgaatg gcgccacttg       360
     ctgcatcggc caagcctcat cagcgcaggg gttctggcgg tgaatgtatt gatcgtggtt       420
     tttctggcgt atcgcttatg gcgccggcgc gtggcaattc gctcaagcaa aaattctatt       480
     gaactatggg gatga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page