(data stored in ACNUC7421 zone)

EMBL: CP000529.PE380

CP000529.PE380       Location/Qualifiers
FT   CDS_pept        complement(380445..382046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35707"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ79"
FT                   /protein_id="ABM35707.1"
FT                   /translation="MDHGLFSDKVPACFTSIGLAKIASDTLKEIFEETDEAKLKKKIKP
FT                   YSHDYIRYDALRDINIPRHLGIPHPGSYAIQALALSKHWQVIAEHCNQPDPSISRVHVR
FT                   KMGSDSIFKMNYKGSERYQLEEDEINWMAGAQFVVKADVASCYPSIYTHSIPWALHDKI
FT                   TTKKNQKITELAGNLLDKCTQNTRDGQTNGLLIGPHASSIISEIILTKIDTDLQKKYKK
FT                   IVRHIDDYTFFADTFDEAEKFVKDLGLCLRSYEMSLNYKKTSILPLPTPSVEDWIHRIN
FT                   SFDFPKDQEIGFSKIRSFLDLALECSRIAGKSTPLSYAIKILAGNTNSIKLNIRAKRLY
FT                   VLEVMNMALVYPYLVPLLDKAVFDKYGHPGLADKVSKLSTSLIRLGVRKLYFDIIAHAF
FT                   YYALKHNVTLDLKDNEFIEIINLNDCISNVMLFAYATKHNLYEVIKEINNFGKLLKLAD
FT                   SREKDKNWLLIYQLWSVSELNGSGQKFLADLKSINFQFLVVPQPVVEVETPDESIISPL
FT                   DSISIDNQLVNVTEQK"
     ttggatcatg gtttattttc cgataaagtt ccagcttgtt ttacatcaat tgggttagcg        60
     aaaattgcat ctgatacatt gaaagaaatt tttgaagaaa cagatgaagc caagttaaaa       120
     aagaaaatta aaccctactc tcacgattac attcgttatg acgcgctgcg ggacatcaat       180
     attcctagac atcttggcat tcctcatcca ggatcttatg ctattcaggc actcgcactt       240
     tcaaaacatt ggcaggtaat tgccgaacat tgcaatcagc ctgatccttc aattagccga       300
     gttcatgttc ggaagatggg tagcgatagt atcttcaaga tgaattacaa aggtagtgaa       360
     cgctaccaac ttgaagaaga tgaaattaat tggatggcag gcgctcaatt cgttgtcaaa       420
     gcagatgtcg cgtcctgcta tccaagtatt tatacgcatt ctattccttg ggcactccat       480
     gacaaaatca caacaaagaa aaaccaaaaa attactgaac tggctggaaa tcttttagat       540
     aaatgcacac aaaatactcg cgatggacaa accaatggtt tacttatagg acctcatgct       600
     tctagcatta tttctgaaat tatattaacc aaaattgata ctgatctaca gaaaaaatat       660
     aaaaaaattg tgcgccacat tgatgactac acattttttg ccgacacctt tgatgaggca       720
     gaaaaatttg ttaaagactt aggtctttgt ttgcgttctt atgaaatgtc acttaattac       780
     aaaaaaacaa gtattttgcc actacctacg cctagtgtgg aagactggat tcatcggatt       840
     aatagttttg attttcccaa agatcaagaa attggatttt caaaaatcag atcttttctt       900
     gatcttgcgt tggaatgttc acgcatagca ggtaaatcca ctcccctaag ctacgcaatc       960
     aaaatcttag caggaaatac aaattctata aaattaaaca taagagccaa acgcctctat      1020
     gttttagaag tcatgaatat ggcgcttgta tatccatacc ttgtaccatt acttgataaa      1080
     gcagtttttg ataaatatgg acaccctggc ttagctgata aagtttctaa gctctcgact      1140
     tcactaataa ggctgggagt tcgaaaactt tactttgaca tcattgcaca tgctttttac      1200
     tacgccctaa aacataatgt cacgctcgat ttgaaagata atgaatttat tgaaataatc      1260
     aacctaaacg attgtatttc caatgttatg ctttttgcat atgcaacgaa acacaacctc      1320
     tatgaagtga tcaaagaaat caacaatttt gggaagctgt taaagttagc agactcgcgt      1380
     gaaaaagata aaaactggtt attaatttat caactttggt cagtaagtga actcaatgga      1440
     agtgggcaaa aatttctcgc cgatttgaaa tctataaatt ttcaatttct tgttgtacct      1500
     caacctgtag tggaagtcga aacgccagat gaatctatta tctcccctct tgattcaatt      1560
     tctatcgaca atcaattggt taatgtaact gagcaaaaat aa                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page