(data stored in ACNUC7421 zone)

EMBL: CP000529.PE381

CP000529.PE381       Location/Qualifiers
FT   CDS_pept        382417..382674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35708"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ80"
FT                   /protein_id="ABM35708.1"
FT                   /translation="MPCPAGAKVRSTAALLVYEADRLAINKIAASAYAASTKSRFSLKN
FT                   QPRTASTQRKHRLQRRQQLLQRRRMHGTQALHQPHLVQRA"
     atgccatgcc cggctggcgc taaggttcgt tcaacggctg cgctgcttgt gtacgaagcg        60
     gaccgactcg ctataaataa aatagctgct agcgcatacg cagcaagcac taaaagccga       120
     tttagcttaa agaatcaacc ccgcaccgcc tcaacccagc gcaaacaccg tctccagcgt       180
     cgtcagcagt tgttgcagcg tcgccggatg cacggcaccc aggcgcttca ccagccgcac       240
     cttgtccagc gtgcgtag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page