(data stored in ACNUC7421 zone)

EMBL: CP000529.PE384

CP000529.PE384       Location/Qualifiers
FT   CDS_pept        385516..385935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0085 uncharacterized conserved coiled
FT                   coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35711"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ83"
FT                   /protein_id="ABM35711.1"
FT                   /translation="MKKSLSVIGLVLVVAAASVACDKIKSPMPELQKSPAPSGQASPPE
FT                   GERTAFAQAAQKELDELKVTIAEFKAKAEASGAQTKTRLGEEVKKLEADLGEAQQRLAA
FT                   LKAATVESWNQVKASFSSSLEQLKRGVENFRKNPV"
     atgaaaaaat ccttgtcggt cattggcctg gtcctcgtgg ttgccgccgc gtccgttgcg        60
     tgcgacaaga tcaagtcgcc catgccggaa cttcaaaaat cccctgcgcc gtcaggccag       120
     gccagccccc cggagggtga gcgcacggcc tttgcgcagg ccgctcaaaa agagctggac       180
     gagctgaagg tgacgattgc cgaattcaag gcaaaagccg aggcttcggg cgcccagacc       240
     aagaccaggc ttggcgagga agtcaaaaaa ctcgaagccg atctgggtga agcgcagcag       300
     cgtttggccg cgctgaaagc cgccacggtg gaatcctgga accaggtcaa agcgtcgttc       360
     agcagttcgc tggagcaact caagcgcggc gtcgagaact ttcgcaagaa cccggtctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page