(data stored in ACNUC7421 zone)

EMBL: CP000529.PE385

CP000529.PE385       Location/Qualifiers
FT   CDS_pept        385951..387585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0389"
FT                   /product="thermosome subunit"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: rfr:Rfer_3009 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35712"
FT                   /db_xref="GOA:A1VJ84"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ84"
FT                   /protein_id="ABM35712.1"
FT                   /translation="MKPKQLIFHDAARGKIWRGVEALAEAVKVTLGPRGRTVILERDFG
FT                   PPQIVNSGVLVAKSIELEDRFENMGAQLLREVAARTSEMAGDGTTTATVLAHGMIQEGL
FT                   RYLAGGMNPMDLKRGIELAIDTVVAELQRMAKPCASSQEIAHVAAISANNDRSIGDLLA
FT                   SAIDKVGREGAISIEDGSGLVSVLEVVEGMQFDRGFLSPYFINNAERQSAVLEDVSILL
FT                   CEGRLTSLNDLLPLLEEVVKAGRPLLVIAEDVDSDSLAALVINTMRGTLKTCAVKAPGF
FT                   GDRRKAMVQDIAVLTGGTVVSDEVGLTLGKVRLQDLGRATRAEITKESTTLIGGAGKPQ
FT                   AIRDRIATIRKERELAASDYDREKLDERAAKLSGGVALIKVGAATETELKERKLRVEDA
FT                   LHATRAAVEEGIVPGGGVALLRARRTLAGLTGGTLDETSGIRLVSRALEEPLRRIVSNA
FT                   GDEPSVILNRVDESPDPAFGYNAATRAYGDLLQMGVIDPAKVTRLALQNAASIASLILT
FT                   TDCMIATAPKPSSEEGALNPEGSSPMF"
     atgaaaccca aacaactcat ttttcacgac gctgccaggg gaaaaatctg gcgcggggtg        60
     gaggcgctgg ccgaagccgt gaaggtcacg ctggggccgc gcgggcgaac cgtgatcctg       120
     gagcgcgact tcggcccgcc gcagatcgtc aactccggcg tgctggtggc caagtcgata       180
     gagcttgagg acaggtttga aaacatgggt gcgcagctgc tgcgcgaagt ggcggcccgc       240
     accagcgaga tggcgggcga cggcaccacc accgccacgg tgctggccca cggcatgatc       300
     caggaggggc tgcgctatct ggccggcggc atgaatccga tggacctcaa gcgcggcatt       360
     gaactggcca tcgacacggt ggtggccgaa ctccagcgca tggccaagcc ctgcgccagc       420
     tcccaggaaa tcgcgcatgt ggcggcgata tcggccaaca acgaccgctc catcggcgac       480
     ctgctggcca gcgccatcga caaggtgggg cgtgaaggcg cgatttccat cgaggacggc       540
     tccgggctgg tcagcgtgct ggaagtggtc gaaggcatgc agttcgaccg gggtttcctg       600
     tcgccgtact tcatcaacaa tgcagagcgg caaagcgccg tgctcgaaga cgtgtccatc       660
     ttgctgtgtg aaggccggct gacttcgctc aatgacctgt tgcctttgct ggaggaagtc       720
     gtcaaggccg gccgcccgct gctggtgatt gccgaggacg tggacagcga ctcgctggcg       780
     gcgctggtga tcaacacgat gcgcggcacc ctgaaaacct gcgccgtcaa ggcgccggga       840
     ttcggcgaca ggcgcaaggc gatggtgcag gacattgcgg tgctgacggg cggcacggtc       900
     gtcagcgacg aggtcgggtt gacgctgggc aaggtcaggc tgcaggatct ggggcgcgcc       960
     acccgcgccg agatcaccaa ggaaagcacc accctgatcg gtggcgcggg caagccgcag      1020
     gcgatcaggg acaggattgc caccatccgc aaggagcgcg aactggccgc cagcgactac      1080
     gaccgcgaaa agctcgacga gcgcgcggcc aagctgtcgg gcggcgtcgc cctgatcaag      1140
     gtcggcgcgg ccacagagac cgagttgaag gagcgcaagc tgcgcgttga agacgccctg      1200
     catgccacgc gcgcggcggt ggaagagggc atcgttccgg gtggcggcgt ggccttgttg      1260
     cgggcgcgcc gcaccctggc ggggctgacc ggcggcacgc tcgatgaaac gtccggtatt      1320
     cggctggtgt cgcgcgcgct ggaagagccc ttgcgccgca tcgtgagcaa tgcgggcgac      1380
     gagccttcgg tgattctcaa ccgggttgac gaatcgccgg acccggcatt tggctacaac      1440
     gcggccacgc gcgcctatgg cgacctgctg cagatggggg tcatcgaccc ggccaaggtc      1500
     acgcggctgg cgctgcaaaa tgccgcctcc attgccagcc tgattctcac caccgactgc      1560
     atgattgcca cggcgcccaa gccgtcatcc gaagagggcg cgctgaatcc ggaaggcagc      1620
     tcgcccatgt tttga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page