(data stored in ACNUC7421 zone)

EMBL: CP000529.PE39

CP000529.PE39        Location/Qualifiers
FT   CDS_pept        complement(40903..41682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: reu:Reut_B4887
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35366"
FT                   /db_xref="GOA:A1VI88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI88"
FT                   /protein_id="ABM35366.1"
FT                   /translation="MWSIRLAISRRSYGLLALVGLLVPLLGWALLSAFAGVSPVFLPGP
FT                   DKVVTRIGTWAMEDDLMGDAFISTMRVVTGWALSALLAIPLGLLIGSWRAVQALLEPLT
FT                   DFIRYMPAVAFIPLVMLWVGIDEGAKVAIIFIGTFFQMVLMVAEDVRRVPMAQIEAAQT
FT                   MGATRREVLEKVILPSAKPALLDTLRITMGWAWTYLVVAELVAANSGLGFAILKAQRFL
FT                   QTDKIFAGILLIGFIGLAIDQLFRLLHRKAFPWLHGR"
     atgtggtcca tacggctggc gatctcgcgt cgcagttatg gcttgctggc gctcgtcggc        60
     ctgctggtgc cgctgctggg ctgggcgctg ctcagcgcct ttgccggggt gagcccggtg       120
     tttttgcccg gccccgacaa ggtggtcacg cgcatcggca cctgggcgat ggaggacgac       180
     ctgatggggg acgccttcat cagcaccatg cgggtcgtca ccggctgggc tttgtcggcg       240
     ctgctggcaa taccgctggg cctgctgatc ggcagctggc gcgcggtgca ggcgctgctg       300
     gagccgctga ccgacttcat ccgctacatg cccgccgtgg ccttcatccc gctggtgatg       360
     ctgtgggtcg gcatcgacga gggcgccaag gtggccatca tcttcatcgg caccttcttc       420
     cagatggtgc tgatggtggc cgaggacgtg cgccgcgtgc cgatggcgca gatcgaggcg       480
     gcgcagacca tgggcgcgac gcgccgcgag gtgctggaaa aagtgatcct gccttcagcc       540
     aagcccgcct tgctcgacac cctgcgcatc accatgggct gggcctggac ctacctggtg       600
     gtggccgaac tggtggcggc caactcgggc ctgggctttg ccattttgaa ggcccagcgc       660
     ttcttgcaga ccgacaagat ctttgccggc atcttgctga tcggcttcat cggcctggcc       720
     attgaccagc tgtttcgcct gctgcaccgc aaggcgtttc cctggctgca cggaaggtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page