(data stored in ACNUC7421 zone)

EMBL: CP000529.PE393

CP000529.PE393       Location/Qualifiers
FT   CDS_pept        complement(394345..396612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0397"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: ade:Adeh_2956
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35720"
FT                   /db_xref="GOA:A1VJ92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ92"
FT                   /protein_id="ABM35720.1"
FT                   /translation="MLKIRTYLVLMAVAILLPVVVFSTVALQMLRDGEREAALRGLQET
FT                   ARATALTVDRELASSVTALELLARSPHLESGDLQAFYKQAALLNKRPTSWTVLLDKNAQ
FT                   QLVNTARPFGEALPLPRDPGRVQEVMETQNSLASDLTVGQVTQKRVTVMYVPVPAHGGT
FT                   RYVLAQVFAIEFFNNTVFQPNTPINWVIAIIGRDGRFIARNLNAQERVGKPASADLMKA
FT                   AGAQDHGLIRHDTLDGTDAYNAFTHSAISGWTIGVAAPVNNIEATAGRAVAIATLGLLI
FT                   AITCAMMMAAFLGRRLVHSIAAATDAAAAMGHGTKPELTRSNVLELDQLHTALMQAGVI
FT                   LELAQASSAQAEEERECLLQDAYKARLRAEAESTAKDQFLAMLGHELRNPLAAIGGAIA
FT                   LSERHGHGSATAAEARAIIQRQSGHLAHLIDDLLDVSRMVGGKITLKPQPVDLGKKARS
FT                   CLESLRATRHMTGYELKVTTEPVWVNADPTRLEQMLNNLLVNAFKFTPPGGLVEVTVSA
FT                   CAQEAVLSVKDSGMGISPELLPHVFEMFVQGSASLDRAQGGLGIGLALVRQLASLHGGT
FT                   VSADSAGPGQGSTFVVRLPRIAAPVALPAAALPASSPHQRWRILLIEDNDDARHMMRRL
FT                   LDMEGHEVLEAATGTAGLRLASQQKPDLAIVDIGLPEMTGYEVAEHLRGDAETRSMGLI
FT                   AMTGYGQQEDRKHALAAGFDVHLVKSVDIDHLLKVIDQCGQAALLRKPGTGTAPIEGAS
FT                   HG"
     ttgttaaaga ttcgcaccta tcttgttctg atggcagtcg ccatcttgct gccggtggtg        60
     gttttttcga ccgtcgcgct gcagatgctg cgcgacggcg agcgcgaagc cgccttgcgt       120
     ggcctgcagg aaactgcccg ggcaaccgcg ctgaccgttg accgggaact ggccagttcc       180
     gtcacggcgc tggaactgct ggcgcgctcg ccccaccttg aaagcggcga cctgcaagcg       240
     ttttacaaac aggccgcgct gctgaacaag cgcccgacat cctggaccgt gttgctggac       300
     aaaaacgccc agcaactcgt caacacggcg cgtccattcg gcgaagcgct gccactcccc       360
     cgagaccccg gcagggtgca ggaggtcatg gagacgcaga actcactggc gtctgacctt       420
     acagtgggcc aggtcacgca aaagcgggtg accgtgatgt atgtgcccgt gccggcgcat       480
     ggcggtacac gctatgtgct ggcccaggtc ttcgcgattg aattcttcaa caacacggtt       540
     ttccagccca acacgccgat caactgggtc atcgcgatca tcggccgcga tggccgattc       600
     attgcacgca acctcaatgc tcaggaacgg gtgggcaagc ccgccagcgc cgatctgatg       660
     aaagccgcag gcgcccagga ccatggcctg attcgccacg atacgctgga tggcaccgac       720
     gcctacaacg ccttcacgca ttcggccatt tccggctgga cgattggggt ggccgctccg       780
     gtcaacaaca ttgaagccac ggcgggccgc gccgtggcga ttgccacgct cggtttattg       840
     atagccatca cctgcgccat gatgatggcg gcttttttgg ggcggcgact ggtgcactcc       900
     attgctgccg caaccgatgc cgcagccgcc atgggccacg gcaccaagcc cgaattgacg       960
     cgctccaatg tactggagct tgaccagttg cataccgccc tgatgcaggc cggcgtcatt      1020
     cttgaactcg cccaagcgtc aagcgcgcag gctgaagaag agcgtgaatg cctgctgcaa      1080
     gatgcctaca aggcacgcct gcgcgccgaa gccgaaagca ccgccaagga ccagttcctg      1140
     gccatgctgg ggcacgagct gcgcaacccg ctggccgcga ttggcggggc catcgccttg      1200
     agcgagcggc acggccacgg gagcgctacc gcagccgagg cgcgcgcgat cattcagcgg      1260
     caaagcggac atctggctca cctgatcgac gacctgctgg acgtgagccg gatggtgggc      1320
     ggaaaaatca ccctgaaacc gcagccggtt gatctgggga aaaaggcccg ttcgtgcctg      1380
     gagtcactgc gcgcaacccg gcacatgacc ggctatgaac tgaaggtcac gaccgagccg      1440
     gtgtgggtca acgccgaccc gacgcggctc gaacagatgc tcaacaacct gctggtcaac      1500
     gccttcaagt tcacgccgcc gggcggcctg gtggaggtga cggtcagcgc ttgcgcgcaa      1560
     gaggccgtgc tgagcgtcaa ggactcgggc atgggaattt cgcccgaact cctgccgcat      1620
     gtctttgaga tgtttgtgca gggaagcgcc agcctggacc gcgcccaagg cggcctgggc      1680
     atcgggctgg cgctggtgcg ccaactggcc agcctgcatg gcggaacggt ttcggccgac      1740
     agcgccggac ccggccaggg cagcaccttc gtggttcgcc tgccgcgcat tgccgcgccc      1800
     gttgcgctgc ctgccgcagc gttgccggca agcagcccgc accagcgctg gcgaatactg      1860
     ctgatcgagg acaacgacga tgcgcgccac atgatgcgcc gcctgctgga catggaaggc      1920
     catgaagttt tggaggcggc caccggcacg gcaggcctgc ggctggccag ccagcaaaag      1980
     cccgacctgg ccatcgtcga tatcggcctg ccggaaatga cgggctacga ggtggccgag      2040
     cacctgcgcg gcgacgccga aacccgaagc atgggcctga tcgccatgac cggctacggc      2100
     cagcaggaag accgcaagca tgccctggcg gccgggtttg acgttcacct ggtcaagtcc      2160
     gttgacatcg accacctgct gaaggtgatt gaccagtgcg gccaggcggc cctgctgcgc      2220
     aagccgggga ccggcaccgc ccccatcgag ggcgcgtccc acgggtga                   2268
//

If you have problems or comments...

PBIL Back to PBIL home page