(data stored in ACNUC7421 zone)

EMBL: CP000529.PE395

CP000529.PE395       Location/Qualifiers
FT   CDS_pept        complement(397480..398220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35722"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ94"
FT                   /protein_id="ABM35722.1"
FT                   /translation="MTLQNPAHPSLQAIALGAEFSDLEEGARYALLQRLAPALQHHMMG
FT                   KFQSMDMIAAMMERRLKSADPDLASIREDCASLSSVSRIAVKSIMDLMTWIEPKTASTV
FT                   KFDAGVVECLGLLATEFRFKGFVIVNEAREIDVKLSSRALRSVLSAALIALSDLSKVSA
FT                   TLVIRAQAMPDRVELTIDLRPTERDTKRAYVTDSRALKWRDVEILALAESVQLERSDTG
FT                   AQLTFALPAANADLPGDLFVGTGI"
     atgaccctgc aaaatccggc acacccttcc ctgcaagcaa tcgctctggg cgctgaattt        60
     tcagatcttg aagaaggggc aagatacgcg ctgctgcagc gcctggcacc ggccctgcag       120
     caccacatga tgggcaagtt ccagtcgatg gacatgattg ccgccatgat ggagaggcgc       180
     ctcaagtccg ccgatcccga tctggccagc atccgcgagg actgcgcctc gctcagcagc       240
     gtttcgcgca tcgccgtgaa atccatcatg gatctcatga cctggatcga acccaaaaca       300
     gcatccaccg tgaaatttga cgccggagtc gtggaatgcc tgggcttgct ggcaacggaa       360
     ttccgcttca agggttttgt gatcgtcaac gaggcgcggg aaatcgatgt caaactttcc       420
     agccgcgcgc ttcgcagcgt cctgagtgcc gcgctgattg cactgagcga tttgtcaaag       480
     gtttccgcca cgctggtgat ccgggcgcaa gccatgccgg accgcgtcga gctgacgatt       540
     gacctgcgcc ccaccgaacg ggatacaaaa agggcctatg tcaccgacag ccgcgccctg       600
     aaatggcgcg atgtcgagat tcttgcgctc gcggaatctg tccagcttga gcgtagcgac       660
     acgggtgcgc aactgacctt tgccctcccg gccgcaaatg cggacttgcc aggggatctt       720
     ttcgtcggca ccggaatctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page