(data stored in ACNUC7421 zone)

EMBL: CP000529.PE40

CP000529.PE40        Location/Qualifiers
FT   CDS_pept        complement(41693..42709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0041"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM: NLPA
FT                   lipoprotein; Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: reu:Reut_B4888 ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35367"
FT                   /db_xref="GOA:A1VI89"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI89"
FT                   /protein_id="ABM35367.1"
FT                   /translation="MSSHFFSLFTISHAFKRSVAGACLVLAGVGAASVPMPAAAEVKVG
FT                   VSDWPGWVAWYVAEQKGFFKKNGADVKLVWFANYTDSIGALSSGQLDANSQTWSDTLGP
FT                   LAKGLPLKAILVNDNSAGNDALMVGPKITSFAQLKGKKVALEQFSISHFVLATALAKNG
FT                   MKLDDVKIVNLSAGDAAAAFISGKVDAAVLWNPWVNQIEKSGKGKALFTSRDMPGLVPD
FT                   LLVAQDKAIQTKRKELVGMIKAWFETEKFIREQPAEAAKIMSKVVSMSPEEYTVFLPGT
FT                   RFFDAAANTRAFDAKQALSLSSTAPTIAAFLTQYKLIEGKPDAAKGIDGTLLQDALK"
     atgtcttctc atttcttctc gcttttcacg atttctcatg cgttcaagcg cagtgtcgcc        60
     ggcgcctgcc tggtgctggc aggcgtgggt gcggccagcg tgccgatgcc tgcagcggcc       120
     gaagtcaagg tcggcgtgtc cgactggcca ggctgggtgg cctggtacgt ggccgagcaa       180
     aaaggctttt tcaagaagaa cggcgccgac gtcaagctcg tctggtttgc caactacacc       240
     gattccatcg gcgcgctgtc ctcgggccag ctcgacgcca actcccagac ctggtccgac       300
     acgctcggcc ccctggccaa gggcctgccg ctcaaggcga ttctggtcaa cgacaactcg       360
     gccggcaacg acgcgctgat ggtcggcccg aagatcacct ccttcgccca gctcaagggc       420
     aagaaagtgg cgctggagca attcagcatt tcgcacttcg tgctggccac ggcgctggcc       480
     aagaacggca tgaagctcga tgacgtgaag atcgtcaacc tgtccgccgg cgacgccgcc       540
     gccgccttca tcagcggcaa ggtcgatgcc gccgtgctgt ggaacccctg ggtgaaccag       600
     atcgaaaaaa gcggcaaggg caaggccttg ttcacctcca gggacatgcc cggcctggtg       660
     cccgacttgc tggtggccca ggacaaggcc atccagacca agcgcaagga gctggtcggc       720
     atgatcaagg cctggttcga gaccgaaaag ttcatccgcg agcaacccgc cgaagccgcc       780
     aaaatcatgt ccaaggtggt cagcatgtcg cccgaggaat acaccgtgtt cctgcccggc       840
     accaggttct tcgacgccgc cgccaacacc cgtgcttttg acgccaaaca ggcgctgtcg       900
     ctgtccagca ccgcgcccac catcgctgcc tttttgaccc agtacaagct gatcgaaggc       960
     aagcctgatg ccgccaaggg cattgacggc acgctgctgc aagacgcgtt gaagtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page