(data stored in ACNUC7421 zone)

EMBL: CP000529.PE400

CP000529.PE400       Location/Qualifiers
FT   CDS_pept        403967..404509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0404"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG:
FT                   pcr:Pcryo_1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35727"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ99"
FT                   /protein_id="ABM35727.1"
FT                   /translation="MAQPTVAASKAAASAAAPAVVKAVSVELTQFKVVKDAKGVEQLVA
FT                   APSVMPGDVIEYKVTYKNTSTKSVGGLVADLPIPEGLEYLPKSAKPGAALVKAAAKDGE
FT                   YAAEPLMRKLPGNKSEPVPYNEYRALRWSLGELPAGGVAAVTARAKVEAVVPTPPKTAP
FT                   ASVPSSAVTVKPASAAR"
     atggcgcaac ccacggtcgc agccagcaag gccgccgctt cggccgctgc gccggcggtg        60
     gttaaagctg tctcggttga gttgacgcaa ttcaaggtgg tcaaggatgc caagggcgta       120
     gagcaattgg ttgctgctcc ctctgtgatg cctggtgacg tgattgaata caaggtcacc       180
     tacaaaaaca ccagcaccaa gtccgttggg ggcttggtgg ccgatctgcc gattcccgaa       240
     ggcctggaat atctgcccaa gagcgccaag ccgggggccg cgctggtcaa agccgcagcc       300
     aaggacggtg aatacgccgc tgagccgctg atgcgcaagc tgcctggcaa caagagcgag       360
     ccggtgcctt acaacgaata ccgcgccttg cgctggagcc tgggcgagtt gcctgcaggc       420
     ggtgttgctg cagtcacggc acgcgccaag gttgaagcgg tggttcccac accacccaaa       480
     accgcgccag cttcagtccc gtcttccgcc gtcaccgtga agcctgccag cgcagcccgc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page