(data stored in ACNUC7421 zone)

EMBL: CP000529.PE402

CP000529.PE402       Location/Qualifiers
FT   CDS_pept        407611..414867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0406"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG:
FT                   pcr:Pcryo_1046 protein of unknown function DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35729"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA1"
FT                   /protein_id="ABM35729.1"
FT                   /translation="MATLLRRLRASRSPGAKHTLLSVCFALFSVPPATATPSGGTEKSQ
FT                   FFLNTNAGLAQRGPRKVSDVLFSSCIQRFIAALALGLAMLLAHVPAQAIPAQAGTVIRN
FT                   VASATYVPAGFTQVETADSNHVLVTVQAVEALSLTQDQNVVRPPSVQVTLNHLLTNTGN
FT                   VRSGYTIGFVGNGAGCPTQILNLSALRVLHDLNNNGVADAGDPVVTLGASGSITLQPGE
FT                   TAGLLVQGTLPASSAGSACVALTATTTAQATTASNRDIITVSNAAVLSLTKTASYPGVV
FT                   VPGTTRIDFTVTGTNIGAQDAQPVGTAAPANTAIVVNGAPINLVLIRDMIPAGTQYMPG
FT                   TLQTTAAGAIRLFRLAGDTAFSYRTEDDASAVEVAIGIPAAVVRNGTVALQFAVRAKAD
FT                   LSGEIRNIAQSYYHDGASPAVSPSNTVIIASSQGRIGVAKAASAPLLNQAANGELDGTA
FT                   TVRFSVLIRNYGSTALYSVQAPDVLEGAGATQFGSYTSNVVPAANQYTIVPGSLVIAKP
FT                   NGSVAGTVAAINPAFNGTAAAQNLLAAGALLPAGADITVQFDARINFTGRTGTLYNTVR
FT                   GQASVSPGDTPGIFDDSSNGTNPDVNGNGNPNDDSLPTPVSTLLPALSIIKTVSLPRRV
FT                   SLGVYEFDYTFKVTNTGQAEAPHVRVIDNLNCTFDMDKAEGAIASWELVTRPIVKHGNL
FT                   KTSASFTGRATCNRNQLNSTDPYLLPTEVVLSLVDGSRPLAPGQSEEVTLTLRVTEKPA
FT                   SIGSHLTLTNKAWAAAFGQNTVNVTPSLLVAAGSNSVRSLLLDPEGTVYNSITRQPVAG
FT                   ALVTYSRLSCSSGAGGPVTAAEIYGSGTGVYTFNANGTVSMTTGADGAWQFFLQSPPVT
FT                   NLCTYGITVAPPVGSGYVASQLIPVTPGSFDSCGAIVPNEAPPQNGEPTTHYFVLRAGV
FT                   NPDNSSCEAIHNHIPLDPGNLMGLVLRKDGSKKTAEFGDFIDYALTLTNKTGFPVTGAT
FT                   FNDFLPAGFAYVPNSARLNGAATANPAGGAGPQLVFSFPSLSLGVDQSATVRYRLRIGV
FT                   GAPTSGDAVNRAQASSGPMQSNQASWRVRVTGGVFSDEAFAFGTVHMECRRDGKEADGL
FT                   KNGGEEIGIPGVRLFMEDGTSVVTDIEGKWSLYGLKPVTHVLRVDETTLPPGAQLDLLD
FT                   NRNANNPASRFVDLKKGEFHKANFIVGNCDAPGVFQDVAARRKSLADRPDAEGEAAVRV
FT                   RLDPEAKAISVGDTRSLPATGQSSLTGAAGITVPASQALIQLPTGTANTNTFIGGVASA
FT                   GALNGTLGQAQQAGAFSPLIPLAGNNEVNGRSGFLLPAAQPLLQQAVPSSIELEKVMHS
FT                   LDNSAGFIDLKDQDTVASQTLNVRVKGAAGTQLRLHVNGQPIDDRRVGKKVVLPSASLG
FT                   AWEYIGVQLKPGINTLRLDVVDDYGVTRGTQQITLVAPDKLSLIQIDAPETAQADLRTP
FT                   VLIKVRLTDASGIPVTGRMQVTLEADRGRWLENDLNPSEPGAQVFIEGGVAEFRLLPPG
FT                   EPGDMRVRVSAGTFVKEARVALLPELRPMIGVGIIEGTLDFTKRSALTLGQMPAGAAFE
FT                   TELSGFASDGTSSSRGAARSAFFFKGAVQGDYLLTAAYDSDKTTKDRLFRDIRPDEFYP
FT                   VYGDSSVRGFDAQSTQKFYVRIDKNRSYLLYGDFTTASSSEVRQMSQSSRTLTGIKNVY
FT                   ESDTVRATSYASRTAQTQRIEEFPALGISGPYHLNAGNGDLLANSEKIEILVRDRNQPN
FT                   IVLQTTSVARFTDYTIEPLTSRLLFTRPIASVDTNLNPQSIRVTYEVDSGGAKFTVAGT
FT                   DVQVKLGEKLQVGMVASTDENPENKRKLGALTAIAHIAESTTVAAELVRTETDLKGTGS
FT                   AGRIEVRHHDEKLGAVAQIAKTSASFDNPGSAFSAGRTEAVARAQYKLDDTTQVRGEAI
FT                   YSKDALTTGDRKGVAVGVQKKLSETLLGEVGVRHGENSSPTASMFDYNQVSSSSALGAG
FT                   SLGNSVTSLGASAAAAGTSNQDITTVRGRLTTVVPHLPQAQVFVEAEQDINHGDRHVLA
FT                   AGGNYAITDKTRAYGRYEFISSLDGPYSLNNSSSRNIGILGIESNYMEGGRVYNEYRLA
FT                   DSLDGRTGQAAMGVRNTFKLNEQWRLTAGIERTKSIGSSASGIVGRGNSTAIVTGAEYL
FT                   SDRVKASGILEARQGDDSNSYLSSLGVGYKIDTDWSLLARSIISESKGQGTNAGNDRLL
FT                   SRQQIGIAYRPVDQDKWNALARYEHKTERVNGAGSVLGAVNSSSVFGSNAPGTYSADIV
FT                   SSHFNYNPQRGTYLTGRYAGKVSSADDGFLGSSYWAHLVQGRYTRDLSRDWDVGLQAGL
FT                   LYGKGGALQKTAGVELGYQVAKDLWVSAGYNVVGLKDRDLTAGEYTSEGVYIRLRFKFD
FT                   ENIFSTALPAVTK"
     atggctaccc tgctccggcg ccttcgggca agccggagcc ctggtgcgaa acacacgctc        60
     ttgagcgttt gtttcgcgct tttttctgtg ccacctgcaa cggcgacgcc atcaggtggc       120
     acagaaaaaa gtcaattttt tcttaataca aacgcagggc tcgcacagcg aggtccgcga       180
     aaagtgagcg atgtgctgtt ttcttcctgt attcaacgct ttatagctgc gctggccctt       240
     ggcctggcca tgctgctggc ccatgtgccg gcacaggcca ttcccgcgca ggctggcacg       300
     gttattcgca atgtggcgtc cgctacctat gtgccggccg gttttaccca agtagaaacc       360
     gctgattcca accatgtttt ggtgaccgtc caggccgttg aagcgttgtc gctgacacaa       420
     gaccaaaacg tcgtgcgtcc tcccagtgtg caggtcacgc tcaatcatct gctgaccaac       480
     accggcaatg tccggtctgg ctacacgata ggttttgtag gcaacggcgc gggctgtccg       540
     acccagatcc tgaacctcag cgccctgcgc gtgctgcacg atctcaacaa taacggggtg       600
     gcggatgctg gcgacccggt cgtcacgctg ggcgccagcg gctccatcac gctgcaaccc       660
     ggcgaaacgg ccggcctgct ggtacaggga accttgccgg cgtcatctgc cggaagcgcc       720
     tgcgtggcgc tgactgccac caccacggcc caggccacca ccgccagcaa ccgcgacatc       780
     atcaccgtca gcaatgcagc cgtcctgtcg ctgaccaaaa ctgccagcta ccccggcgtg       840
     gtagtgccag gcacgacccg catcgacttc accgttaccg gcaccaacat cggtgcgcaa       900
     gacgcgcagc ctgtcgggac ggctgccccc gccaacaccg ccatcgtggt caatggcgcg       960
     ccaatcaacc tggtgctgat tcgcgacatg attcctgccg gcacgcagta catgccgggc      1020
     acgttgcaaa ccaccgctgc tggcgccatt cgcctgttcc gcctggcagg tgacactgcc      1080
     ttcagctatc gcaccgagga cgacgcttcc gcagtggaag tggccatcgg tattccggct      1140
     gctgtggtgc gaaacggcac cgtggccctg cagtttgccg tgcgcgccaa ggctgacctg      1200
     agcggcgaga tccgcaacat tgcacaaagc tattaccatg acggcgccag ccccgcagtg      1260
     tcgccttcca acacggtcat tattgcgtcc agccagggcc gtatcggcgt ggccaaggcc      1320
     gcttcggcgc ccttgctgaa ccaggcggcc aatggcgagt tggacggcac agccaccgtg      1380
     cgcttcagcg tgctcatacg caactacggc agcactgcgc tgtattccgt acaggcgcct      1440
     gatgtgctgg aaggcgctgg cgccacgcag tttggcagct acaccagcaa tgtcgtacct      1500
     gctgccaacc aatacaccat cgttcctggt tcgctggtca tcgccaaacc caacggcagc      1560
     gtggctggca cggtagcagc catcaacccc gcatttaacg gcaccgcagc agcgcaaaac      1620
     ctgctcgccg ctggcgcgct gttgccggca ggcgcggata tcacggtgca gttcgatgcg      1680
     cgcatcaact ttaccggccg cactggcacg ctgtacaaca ccgtgcgcgg ccaggcgtcc      1740
     gtcagtcctg gcgacacgcc cggtattttt gacgactcgt ccaacggcac caaccccgat      1800
     gtgaacggca atggcaaccc caacgacgac agtttgccca cgccagtgtc cacactgctg      1860
     ccagccctgt cgatcattaa aactgtttcc ctgccgcgtc gcgttagcct gggcgtgtat      1920
     gagttcgact acaccttcaa ggtcaccaac accggccagg cagaggcacc ccatgtgcgg      1980
     gtcatcgata acctgaactg cacctttgac atggacaagg ccgaaggcgc cattgcctcg      2040
     tgggaactcg tcacccggcc catcgtcaag cacggcaacc tcaagacttc agccagcttc      2100
     accggccggg caacctgcaa ccgcaaccag ttgaacagca ccgaccctta cctgttgccc      2160
     acggaagtgg tgctgtccct ggtggacggc agccgtccgc tggccccggg ccaaagtgaa      2220
     gaggtcacct taaccttgcg cgtcaccgaa aagccggcct ccattggatc gcacctcacg      2280
     ctgaccaata aagcctgggc ggccgcgttt ggacaaaaca cagtcaatgt cacgccctca      2340
     ctgctggttg cggcgggatc gaattcagtt cggtccctgc tgctcgaccc ggaaggcacg      2400
     gtttacaact ccatcacacg ccagcccgtg gccggcgcac tcgttaccta cagccgcctg      2460
     tcctgcagca gtggcgcagg cggtcctgtt accgcggcag aaatttacgg cagcggaaca      2520
     ggggtttaca cattcaatgc caatgggacg gtgtccatga ccacaggcgc ggatggcgcc      2580
     tggcagttct ttctgcaatc gccgccagtc accaacctgt gcacctacgg catcacggtg      2640
     gcgccaccag tgggcagcgg ctatgtggct tcccaactga ttcccgtcac cccgggcagc      2700
     tttgacagct gcggtgccat tgttcccaat gaagcgcccc cacaaaatgg cgagcccaca      2760
     acgcattact ttgtcttgcg cgccggtgtg aatcccgaca actccagttg cgaagccatc      2820
     cacaaccaca ttccgctaga ccctggaaat ctgatggggc tggtgctgcg caaagacggt      2880
     agcaagaaaa cggcagagtt cggcgacttc atcgactatg ccctcacgct gaccaacaag      2940
     acgggttttc ctgtcactgg cgctactttc aacgacttct tgccagccgg gtttgcctat      3000
     gtgcctaaca gcgcccgcct gaatggcgcg gccaccgcca acccggcggg tggcgcaggc      3060
     ccccaactcg tgttcagttt tccgtccttg tcgcttggcg tggatcagtc cgccacggtg      3120
     cgctatcgcc tgcgcattgg tgtgggcgcg cctacatcgg gcgacgcggt caatcgcgca      3180
     caagccagtt ccggcccgat gcagtcgaac caggcgtcat ggcgcgtgcg cgtcaccggt      3240
     ggtgtttttt cagacgaagc ctttgccttc ggcacggtcc atatggagtg ccgccgcgat      3300
     ggcaaggagg ctgatggcct gaaaaatggg ggcgaagaaa taggcattcc cggtgtgcgc      3360
     ctcttcatgg aggacggcac cagcgtcgtt accgatattg aaggcaagtg gagtctgtac      3420
     ggtctcaagc cggtcacgca cgtcttgcgt gtggatgaaa ctacgttgcc gcccggcgcc      3480
     cagctcgacc tgctggacaa ccgcaacgcc aacaacccgg ccagtcgttt tgtcgatctg      3540
     aaaaaaggcg agtttcacaa ggccaacttc atcgtcggca actgcgatgc gccgggcgtg      3600
     tttcaggacg tagccgcccg ccgcaagagc ttggccgacc ggcctgacgc agaaggcgaa      3660
     gccgcagtac gcgtgcgcct tgatcccgaa gccaaagcca tcagcgtggg ggacacccgt      3720
     tccttgcccg ccaccggcca gtccagcctt acgggcgccg ctggcatcac cgtgccggca      3780
     agccaggcgt tgatccagtt gcccactggc accgctaata ccaatacctt catcggtggc      3840
     gtggccagtg ctggcgcgct caatggcacg ctgggccagg cgcaacaagc cggcgctttt      3900
     tccccgctaa ttcccctggc tggcaataac gaggtcaatg gccgcagcgg cttcttgctg      3960
     cccgctgccc agcctttgct gcaacaagcc gtgcccagca gcatcgagct tgaaaaagtc      4020
     atgcatagcc tggacaacag cgccggcttt atcgacctga aagaccaaga cactgttgcc      4080
     agccaaaccc tcaacgtacg tgtcaagggc gcggccggca cgcaactgcg cctccacgtc      4140
     aacggccagc ctattgacga ccggcgggtc ggcaaaaaag tcgtgctgcc ttcggccagt      4200
     ctgggcgcct gggaatacat tggcgttcag ctcaagcccg gcatcaatac cctgcgcctg      4260
     gatgtggtgg acgactacgg cgtgacccgc ggcacccagc agatcactct ggtagcaccc      4320
     gacaaactca gcctcattca gatcgatgcg cctgaaaccg cccaggccga cttacgcacc      4380
     ccggtgctga tcaaggtacg gctgaccgat gccagcggca tacccgtcac cggccgcatg      4440
     caggtcacac tggaagccga ccgcggtcgc tggcttgaga acgacctcaa cccgagtgag      4500
     cctggcgccc aagtcttcat cgaaggcggc gttgccgagt tccgcctgct gccgcccggc      4560
     gagcccggtg atatgcgggt gcgcgtgtcg gcaggcactt tcgttaaaga agcccgcgtg      4620
     gccttgctgc ctgagttgcg ccccatgatc ggcgtcggca tcattgaagg aacgctcgac      4680
     ttcaccaaac gcagcgcgct cacgttgggc cagatgcctg ccggcgctgc ttttgaaacc      4740
     gagctctccg gtttcgcgtc tgatggcacc tccagttcac gcggtgccgc gcgcagcgct      4800
     ttcttcttta aaggtgcggt ccaaggcgac tacctgctga cagccgctta cgactctgac      4860
     aaaaccacca aggaccgcct ctttcgcgac atccgtccgg acgagttcta tcccgtttac      4920
     ggcgactctt cggtgcgcgg ctttgacgcg caaagcacgc aaaaattcta tgtgcggatc      4980
     gataaaaacc gctcatacct cttgtatggc gacttcacca cggccagcag ttctgaagtc      5040
     cgtcagatga gccagtccag ccgcacgctg accggcatta aaaatgtgta cgaaagcgac      5100
     accgtgcgtg ccaccagcta tgcttcgcgc acggcgcaaa cccagcgtat cgaagaattt      5160
     cccgcgcttg gtatttcggg gccctaccac ctcaatgctg gcaatggcga cctgcttgcc      5220
     aacagtgaaa agattgaaat tctggtgcgt gaccgcaacc agcccaacat cgtattgcag      5280
     accacgtcgg ttgcgcgttt taccgactac accattgagc cgctgaccag tcgcttgctg      5340
     ttcacccgtc cgattgcttc agttgatacg aatctcaacc cgcagtccat ccgggtcact      5400
     tatgaagttg acagcggcgg ggcgaagttc accgtggccg gcaccgatgt tcaggtcaag      5460
     ctgggtgaaa agctgcaggt cggcatggtc gccagcaccg atgaaaaccc tgaaaacaaa      5520
     cgcaagctgg gcgccctgac cgccatcgcc catattgctg agtcaaccac ggttgccgcc      5580
     gaactggtgc gcaccgaaac ggacctgaaa ggcactggaa gcgctggccg aattgaagtg      5640
     cgccaccacg acgaaaaact gggtgccgtg gcacaaatcg ccaaaaccag cgccagcttc      5700
     gacaatcccg gctcagcctt cagcgccggc cgcaccgagg ccgtggcccg tgcgcaatac      5760
     aagttggacg acaccacgca ggtacgcggc gaagccatct acagcaagga cgcgctgacc      5820
     accggtgacc gcaagggcgt tgccgtgggt gtgcagaaga aactcagcga gaccctgttg      5880
     ggtgaggtcg gtgtacgtca cggtgaaaac tccagcccca ccgcatcgat gtttgactac      5940
     aaccaggtct ccagcagcag cgcgctgggc gctggctcgc ttggcaattc cgtcaccagc      6000
     ctcggcgctt ccgccgctgc tgctggcacc agcaaccagg acatcacgac cgttcgtggg      6060
     cgcctgacca ctgtggtgcc ccatcttcct caggcccagg tattcgttga agcggagcag      6120
     gacatcaatc acggcgaccg tcatgtgttg gccgccggtg gcaactacgc catcactgac      6180
     aaaacccgcg cctatggacg ctatgaattc atttccagcc tggacggtcc ctacagcctg      6240
     aacaactcgt ccagccgcaa catcggcatc ctgggcatcg agagcaacta catggaaggg      6300
     ggccgcgttt acaacgaata ccgcctggcc gattcgctcg atgggcgcac cggccaggcc      6360
     gccatgggtg tgcgcaacac tttcaagttg aacgagcagt ggcgtctgac tgctggcatc      6420
     gagcgcacca agtccatcgg gagcagcgcc tccggcatcg tcggccgggg caactcgaca      6480
     gccatcgtca ccggcgcgga gtacctgagt gaccgtgtca aggccagcgg cattcttgaa      6540
     gcccgtcagg gcgatgacag caatagctat ctttcgagcc tgggcgtggg ttacaagatt      6600
     gataccgact ggtccttgct ggcacgcagc atcatcagcg agagcaaggg ccaaggcact      6660
     aacgccggca acgaccgttt gctgtcacgc cagcaaattg gcatcgccta ccgcccggtc      6720
     gatcaggaca agtggaacgc cctggcccgt tatgagcata aaaccgagcg tgtcaacggc      6780
     gccggctctg tgctgggcgc tgtgaacagc agcagcgttt tcggcagcaa tgcccccggt      6840
     acttacagtg cagacatcgt gtcgtcgcac ttcaattaca accctcaacg cggcacttat      6900
     ctcactggcc gctacgccgg caaggtgtcc agcgctgacg acggcttttt gggcagcagc      6960
     tactgggcgc atctggtcca gggtcgctac acgcgcgatc tgtccaggga ctgggacgtt      7020
     ggcttgcagg ccggcctgct gtacggcaag ggcggtgcgc ttcaaaagac tgccggtgtt      7080
     gagttgggtt accaggtcgc caaagacctg tgggtgtcgg ctggctataa cgtcgttggc      7140
     ttgaaagacc gcgacctcac cgccggtgag tacaccagcg agggcgtcta tatccgcctg      7200
     cgcttcaagt ttgatgaaaa cattttttca accgccttgc ccgctgtcac taaataa         7257
//

If you have problems or comments...

PBIL Back to PBIL home page