(data stored in ACNUC7421 zone)

EMBL: CP000529.PE411

CP000529.PE411       Location/Qualifiers
FT   CDS_pept        431574..433643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0415"
FT                   /product="Recombinase"
FT                   /note="PFAM: regulatory protein, MerR; Resolvase,
FT                   N-terminal domain; Recombinase; KEGG: ret:RHE_PA00038
FT                   probable insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35738"
FT                   /db_xref="GOA:A1VJB0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB0"
FT                   /protein_id="ABM35738.1"
FT                   /translation="MTTSDLLPAAVLRRKAVVYVRQSTQSQVQTNLESQRRQYDLVAQA
FT                   RRLGFAQVEVIDDDLGRSASGMVDRPGFERLVAWLCAGEVGAVLCFDASRLARNGRDWH
FT                   HLLELCGLVEARVIDPDGVYDPCRPNDRLLLGMKGSISEFELGVIRARMFEAARAKAHR
FT                   GELRISVPIGYVWHRQIGLGLDPDMRLQETIRLIFARFRTLGSARQVMLSLAADDVHFP
FT                   RPSDGKKMVSFDWTPIRYRNVISILKNPFYAGVYAYGKSEKRTTLVQGRLRKTYKHGKP
FT                   LDRWDVMIKDHHEAYIDWAEFERNQKQLAVNAYGKVDGTKSGRGGRALLAGMLCCGRCG
FT                   RRLTVAYTGRGVPQPVYRCDRPNLQLAQPRCFTFGARRPDEAIARELLRAVEPLAVEAA
FT                   LQAERRYMQVQADQRRIVELELQQARYEAGLAERRYAACDPDHRLIAAQLEKSWEAALQ
FT                   RVLACEQRLNVARQVQSSARPDLTGLEEDLAAAWDAPGVTMRARQQLLRTLVKDIVADV
FT                   DDQAREVVLTIHWRGGQHSQVRVVKPRTGEHGCRTPDEALAVMRSMAGKWSDEHIAATL
FT                   NRMGLPTGQAKTWTAHRVSSVRRVNDIHAYRSAEKDGQWLTMSEAAAKLGVNNHRIRRL
FT                   IKEGLLPAEQVVPRAPYQIRASDLLEQRVIDAIARTLSPCRAVSEKQMSMFSST"
     atgacgacct ctgatctgtt gccggccgca gtgctgcgtc gcaaagctgt cgtctatgtg        60
     cgccagtcaa ctcagtcaca agtgcagacc aacctggaga gccagcgccg gcagtacgac       120
     ctggtggcgc aagctcgccg cctcggattt gcgcaggtgg aagtcatcga cgatgacctc       180
     ggccgttccg ccagcggtat ggtggaccga ccgggctttg agcggctcgt ggcctggttg       240
     tgcgctggcg aagtcggcgc cgtcttgtgc ttcgacgcct cccggcttgc ccgcaatgga       300
     cgtgactggc accacctgct ggagctgtgt ggcctggtcg aggcacgggt cattgacccg       360
     gacggcgtgt acgacccgtg ccggcccaac gaccgtctgc tgctgggcat gaagggcagt       420
     atcagcgagt tcgagctcgg cgtgatcagg gcaaggatgt tcgaagcggc tcgtgccaag       480
     gcgcatcgcg gtgaattgcg catcagtgtc cccatcggct acgtctggca ccggcagatc       540
     gggttggggt tggatccgga catgcgcctg caggagacga tccggttgat cttcgcgcgc       600
     tttcgcacgc tcggcagcgc caggcaggtg atgctttccc ttgcggcaga cgatgtccat       660
     ttcccacggc cctcggacgg caagaagatg gtgagctttg actggacgcc gatccgctac       720
     cgcaacgtga tctcgatact caagaatccc ttctatgccg gcgtctatgc atacggcaag       780
     agtgagaagc gtacgacgct cgtgcaaggg cgacttcgca agacctacaa gcatggcaag       840
     ccgctcgatc ggtgggacgt gatgatcaag gatcatcacg aagcctacat cgactgggcc       900
     gagttcgaac gtaatcaaaa gcagcttgcc gtcaatgcct acggtaaagt cgatggaacg       960
     aagtccgggc gcggtggccg ggcgttgctc gcgggaatgc tgtgctgcgg gcgttgtggg      1020
     cggcgcctga cggtggcgta tacggggcgc ggggtgcctc aaccggtgta ccgatgtgac      1080
     cgccccaatc ttcagctcgc tcagccgaga tgcttcacgt ttggcgcacg ccgacccgac      1140
     gaagcgattg cccgggagct gctgcgcgct gtggagccct tggccgtcga ggcggcattg      1200
     caggctgagc ggaggtatat gcaagttcaa gcggaccagc gacgaatcgt ggagctggag      1260
     ttgcagcagg cccgttacga ggctggtttg gcagagcgcc gctacgcggc ctgtgaccca      1320
     gaccatcgct tgattgccgc acaactggag aagagctggg aggctgcttt gcagcgcgtg      1380
     ctcgcctgtg agcagcgctt gaacgtggcc cggcaggtgc agtcctctgc caggcccgac      1440
     ttgaccggct tggaggaaga tctcgcggcc gcgtgggatg cgccgggcgt gaccatgcgc      1500
     gcgcgccagc agttgctgcg cacactcgtc aaggacatcg ttgccgatgt cgacgaccag      1560
     gcccgcgagg tcgtgctgac gattcactgg cgcggaggcc agcattcgca ggtgagggtc      1620
     gtcaagccac gcacaggcga gcacggctgc cgcacgcccg atgaagccct ggccgtcatg      1680
     cgcagcatgg caggcaagtg gtctgacgag cacatcgccg cgacgctcaa tcgcatggga      1740
     ctgcccacgg gccaggccaa gacgtggacc gcgcatcgcg tgagctccgt gcgcagggtc      1800
     aacgacatcc atgcgtaccg ctcggccgag aaggacgggc agtggttgac catgtcagaa      1860
     gcggctgcca agctcggggt caacaaccac cgcattcggc gcctgatcaa ggagggattg      1920
     ctgccggccg aacaggtggt gccgcgggcg ccgtatcaga ttcgggccag cgacctgctc      1980
     gagcagcggg tgattgacgc catcgcgcga acactcagcc cgtgtcgggc cgtcagcgag      2040
     aagcagatgt caatgttttc aagcacttaa                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page