(data stored in ACNUC7421 zone)

EMBL: CP000529.PE416

CP000529.PE416       Location/Qualifiers
FT   CDS_pept        complement(437610..438173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgl:SG2354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35743"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB5"
FT                   /protein_id="ABM35743.1"
FT                   /translation="MGWGEEEFKTIELGDERLNRRAVLLAERLGQKPSASIPGACQSWA
FT                   ETAAAYRFLRNEEVSWDKVLAPHLQASQARMAQHQVVLCLQDTTELDYHGQDIAGLGPL
FT                   NYEAQRGLYLHPTYVVSPEREPLGVFNAWTWAREFKAADGKRGGPCESTRWIDGMDSPC
FT                   FLRHIGALVFIGVEIRSLNKRSPT"
     atgggctggg gcgaggaaga gttcaagaca atcgagctgg gcgatgagcg cctgaaccgg        60
     cgcgccgtgc tgctggcaga gcgactgggg caaaagccct cggccagcat tcccggcgcc       120
     tgccagagct gggcagaaac ggcagcggct taccggtttt tgcgcaacga agaggtgagc       180
     tgggacaagg tgctcgcgcc ccacttgcag gccagccagg cgcgcatggc acagcaccaa       240
     gtggtgctgt gccttcagga cacgaccgag ctggactacc acggacagga catcgcaggt       300
     ctggggccct tgaactacga ggcccagcgc gggctgtatt tgcaccccac ctatgtcgtg       360
     agtcccgagc gtgagccgct gggcgtattc aatgcctgga cgtgggcgcg cgaattcaag       420
     gcagcagacg gcaaacgcgg cgggccgtgc gaaagcaccc gctggattga tgggatggac       480
     tccccctgtt ttttgcgcca cattggcgct ctggttttca ttggcgtgga gatcaggtct       540
     ttaaacaaaa ggagtccgac atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page