(data stored in ACNUC7421 zone)

EMBL: CP000529.PE42

CP000529.PE42        Location/Qualifiers
FT   CDS_pept        complement(43586..44605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0043"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: gka:GK1971 C4-dicarboxylate transport system
FT                   (C4-dicarboxylate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35369"
FT                   /db_xref="GOA:A1VI91"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI91"
FT                   /protein_id="ABM35369.1"
FT                   /translation="MTFLRRTVIAAAAAVALSASFSALAQDIKPRLIRFGYGLNEQSNQ
FT                   GRAAKVFADEVAKASGGKMKVRAIGAAALGPDTQMQQALIGGAQEMMVGSTATLVGITK
FT                   EMALWDTPFLINNTKEADALLDGPIGEKIKDKLQDKGLVGLVYWENGFRNLTNSKRPVT
FT                   KVEDLDGIKLRVMQNNVFLSSFKTLGANAIPMAFSELFGALETKTVDGQENPYNTILSS
FT                   KFYEVQKYLTVTNHVYSPWIVLVSKKWWDQLSKAEQKVLMDAAKTSRDYERKDTREEAS
FT                   KAMADLKAKGMLVNELAPAEADRMRNKLTRVYAEIGTEVGMDLWIATQNELLKIRGKK"
     atgacttttc ttcgtagaac cgtgattgcc gccgccgctg ccgtggcctt gagcgcctcg        60
     ttttccgcgc tggcgcagga catcaagccg cgcctgatcc gcttcggcta cggcctgaac       120
     gagcaaagca accagggccg cgccgccaag gtattcgccg acgaggtcgc caaggcctcg       180
     ggcggcaaga tgaaggtgcg cgccatcggc gccgccgcgc tcggccccga cacgcagatg       240
     cagcaggccc tgattggcgg cgcgcaggaa atgatggtcg gctcgaccgc cacgctggtc       300
     ggcatcacca aggaaatggc gctgtgggac acgcccttcc tgatcaacaa caccaaggaa       360
     gccgacgccc tgcttgacgg cccgattggc gagaagatca aggacaagct gcaggacaaa       420
     gggctggtcg gcctggtcta ttgggaaaac ggctttcgca acctgaccaa cagcaagcgc       480
     ccggtcacca aggtcgagga tctggacggc atcaagctgc gcgtgatgca gaacaacgtg       540
     tttttgagca gcttcaagac gctgggcgcc aacgccattc cgatggcgtt ttccgaactc       600
     ttcggcgcgc tggaaaccaa gaccgtcgat ggccaggaaa acccgtacaa cacgattttg       660
     tcgagcaagt tctacgaggt gcagaagtac ctgacggtga ccaaccacgt ttacagcccg       720
     tggatcgtgc tggtcagcaa gaagtggtgg gaccagctgt ccaaggccga gcagaaggtg       780
     ctgatggacg cggccaagac cagccgcgac tacgagcgca aggacacgcg cgaggaagcc       840
     tccaaagcca tggccgacct caaggccaag ggcatgctgg tcaatgagct ggcgcccgca       900
     gaagccgacc gcatgcgcaa caagctgacc cgcgtgtatg ccgaaatcgg caccgaagtc       960
     ggcatggacc tgtggattgc cacgcagaac gaactgctga agattcgcgg caagaaatga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page