(data stored in ACNUC7421 zone)

EMBL: CP000529.PE420

CP000529.PE420       Location/Qualifiers
FT   CDS_pept        complement(439931..441178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0425"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bxe:Bxe_C0019 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35747"
FT                   /db_xref="GOA:A1VJB9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB9"
FT                   /protein_id="ABM35747.1"
FT                   /translation="MEPRPRAPQTGELPRPRLDEQLKMSHPLIRLASLMNWEEIERSFG
FT                   AHFTSSRGRPALRPRLVAGLLYLQHANDASDKAVVATWLENPYWQYFCGETYLQTELPI
FT                   DPSSLTRWRKRIGEEGVEVLLAVTIEAARAAGLIKKSSLNQVIVDTTDSRLLEKSRQHL
FT                   VKLADEHHLQLRQNYNRQAPRMAAQIGRYAHARQFKRMRKMLKALRVRVARVYREVMRK
FT                   LGQLPEQTQSKARDLLHRVGRILNQRTKDKNKLYALHAPEAECISKGKARTPYEFGVKV
FT                   SIASTLREGLVVGMRSMPGNPYDGHTLDETIEQVEILAEKRPGIAIVDKGYRGAQVDGV
FT                   QILRSGQRRSITRTMKAMIKRRSDIEPTIGHMKTDGRLARNPLKGELGDALHAVLCGAG
FT                   HNLRLIINKLKIPCAP"
     atggaaccca gaccgcgcgc accccagacg ggcgagttgc cccgcccccg cctggacgag        60
     cagctcaaga tgagccaccc cttgattcgc ctggccagcc tgatgaactg ggaggagatc       120
     gaacgcagct ttggcgccca cttcacgtca agccggggac gccctgcatt gcgccctcgc       180
     ctggtcgcgg ggctcctgta tctgcagcat gccaacgacg ccagcgataa agcggtggtg       240
     gcgacctggc tggaaaaccc ctactggcaa tacttttgcg gtgaaaccta tctgcagacc       300
     gagctgccca tcgacccctc cagcctgacg cgctggcgaa agcgcatcgg tgaagaaggc       360
     gttgaggtgt tgctcgccgt caccatcgag gcagcccgcg cagcaggcct gatcaaaaaa       420
     agcagcctga accaagtcat cgtcgatacc accgacagcc gattgctgga gaaaagccgc       480
     caacacctgg tcaagctcgc cgatgaacac catttgcaat tgcgccagaa ctacaaccgg       540
     caggcgccgc gcatggccgc gcaaatcggc cgctacgcgc atgccaggca attcaagcgc       600
     atgaggaaaa tgctcaaagc cctgcgagtc cgggtggccc gcgtgtaccg cgaagtcatg       660
     cgcaagttgg gccaattgcc agagcagacg cagtccaagg cgcgggatct gctgcaccgc       720
     gtgggccgca tcctgaatca aagaaccaaa gacaaaaaca aactgtacgc gctgcacgca       780
     ccggaggcag agtgcatctc gaaaggcaag gccaggacgc cctacgagtt tggcgtcaag       840
     gtcagcattg ccagcaccct cagggaaggc ctggtggtcg ggatgcgcag catgccgggc       900
     aatccgtacg acgggcacac gctcgatgaa accatcgagc aggtcgaaat cctcgccgag       960
     aaaagacccg gcattgccat cgtggacaag ggttaccggg gcgcgcaggt cgacggggtg      1020
     cagattctgc gctcaggcca gcgccggagc atcacccgaa ccatgaaggc gatgatcaag      1080
     cggcgaagcg acattgagcc aaccatcggc cacatgaaaa cggacggccg gctggcccga      1140
     aatccactca aaggtgagct gggtgacgcc ttgcatgccg tgttgtgcgg cgcaggccat      1200
     aaccttcgcc tgatcatcaa taaactaaaa attccctgtg ctccgtaa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page