(data stored in ACNUC7421 zone)

EMBL: CP000529.PE421

CP000529.PE421       Location/Qualifiers
FT   CDS_pept        441484..442551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0426"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_1212 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35748"
FT                   /db_xref="GOA:A1VJC0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC0"
FT                   /protein_id="ABM35748.1"
FT                   /translation="MSNITRVGVDLAKNVFQVHAVDASGNVVTNRMLKRDRFLAWCCDL
FT                   PPGCLVAMEACSGAHHWCRQLRDRGLDARMIAAQFVAPYRIQGKSGKNDANDAAAICEA
FT                   ASRPHMNFVPPKTLAQQGMLCVHRLREGLKQERTACINRIRGLLAEFGIVLPQSPQVLR
FT                   QHLSDLIEDAGNDIAGMARLVLQRAQEHWREIEEHVQWCDQRIAAHQKDDEQVQRAAEL
FT                   KGIGPVTASAVVATVGDFKQFKNAAQFGAWLGLTPKQNSSGGKSSLSSITKRGSNYLRG
FT                   LLIQGAKSVVLVGKHNDDPISQWAQRLRERCGWQKAVVALANKNARILWAVMTKEKRYD
FT                   AFHVSIPPSAIAATA"
     atgagcaaca ttacacgagt cggcgttgat ttggccaaga atgttttcca ggttcacgct        60
     gtggatgcca gtggcaacgt ggtcactaac cggatgctca agcgtgaccg atttctggca       120
     tggtgttgcg atctgccgcc cggctgcctg gtcgcgatgg aagcttgcag tggcgcccat       180
     cactggtgtc ggcaactccg cgatcgaggc ctggacgcca ggatgattgc agcccagttc       240
     gttgcgccgt accgtattca gggcaagagc ggcaagaacg atgccaacga tgcagcagcg       300
     atttgcgagg cggcctcaag accgcacatg aatttcgtgc cgcccaagac ccttgctcag       360
     caaggcatgc tgtgcgtgca tcgcctgcgt gaagggctca aacaagagcg cactgcctgc       420
     atcaaccgaa tccgaggttt gctggccgag tttggcatcg ttctgcctca aagcccacag       480
     gtgctgcgac aacacttgag tgacctgatt gaggatgctg gcaatgacat cgccggcatg       540
     gcacggctgg ttctgcaaag agcgcaagag cactggcgag aaatcgaaga gcacgtccag       600
     tggtgcgacc agcgcattgc cgctcatcag aaggacgatg agcaggtcca gcgcgcagca       660
     gagctcaagg gcattggacc cgtcaccgcc tcagcggtcg tggcgacggt gggcgacttc       720
     aagcagttca agaacgcagc gcagttcggc gcctggctgg ggctgacacc gaagcaaaac       780
     tccagcggag gcaagtcaag tctgagcagc atcaccaaac ggggcagcaa ttacttgcgc       840
     ggcttgctga ttcagggcgc caagtcagtc gttttggttg gcaagcacaa cgacgatccc       900
     atctcacagt gggcgcagcg ccttcgcgag cgatgtgggt ggcaaaaagc cgtcgtggcc       960
     ttggccaaca agaacgcccg gattttgtgg gccgtcatga cgaaggaaaa gcgctatgac      1020
     gcctttcacg tcagcatccc accttcagcc attgccgcca cagcgtaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page