(data stored in ACNUC7421 zone)

EMBL: CP000529.PE422

CP000529.PE422       Location/Qualifiers
FT   CDS_pept        442923..443963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0427"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bxe:Bxe_C0485
FT                   putative transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35749"
FT                   /db_xref="GOA:A1VJC1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC1"
FT                   /protein_id="ABM35749.1"
FT                   /translation="MKITAQLPVVGMDIAKNVFQIHAVDPETGEIERIKLKRAKVAEFF
FT                   ANRQPCLVALEACGGAHHWGRTLAAQGHQVKLLPARQVKAFVLRDKTDARDAQAIWVAA
FT                   QQPHIHEVPVKSEPQQACLALHRMRAQLMKMRIMQTNALRGLLCEFGIVLPEGHRILLQ
FT                   RIPGELAQAQDKLPGVLIESMQEQLSRIERLQQDIDHIDRRLAALGKQDQHMLALQAVP
FT                   GIGPLTATALAATATDISGFHSGRQFAAWLGLTPRQSGTGGKIRQLGISKRGDPYVRTL
FT                   LMHGARAIIARTQRTGWITALLARRPYSVVVAALANKLARTAWAVLTKGKAFDQLRWNP
FT                   AAAVAA"
     atgaagatta ccgcacaact gcccgtcgtt ggaatggaca ttgccaagaa tgtgtttcag        60
     attcatgccg ttgatccgga aacaggcgag atcgagcgca tcaagctcaa gcgcgccaag       120
     gtggccgagt tcttcgccaa ccgccagccc tgcctggttg ccctggaggc ttgcggcgga       180
     gcccaccact ggggacgaac gctggcagcc cagggccacc aagtcaagct gctgccagcc       240
     agacaggtca aggccttcgt gctgcgtgac aagaccgatg cgcgcgatgc ccaggcgatc       300
     tgggtcgcgg cccagcagcc gcacatccat gaggtgcccg tcaagagcga gccgcagcag       360
     gcttgcctgg ccctgcaccg catgcgcgcc cagctgatga agatgcgcat catgcaaacc       420
     aacgccctgc gtgggttgct ctgcgagttc ggcatcgtgc tgcccgaagg ccatcgcatc       480
     ttgctgcagc gcattcccgg tgaactggcc caggcgcagg acaagctgcc tggcgtgctc       540
     atcgagagca tgcaggagca gctcagccgc attgagcggc tgcagcaaga catcgatcac       600
     atcgacaggc gcctggcagc gctgggcaaa caagaccagc atatgctggc cttgcaggcg       660
     gtgccgggca ttggccctct cacggccacg gccttggcgg ccacagccac cgacatctcc       720
     ggctttcact cgggccggca gtttgccgca tggctgggct tgacgcccag gcagagcggc       780
     acgggcggca agatccgcca gctgggcatc tccaagcgag gcgatccata tgtgcgaacg       840
     ctgctgatgc acggggccag ggccattatt gccaggacgc agcgaacagg ctggatcacc       900
     gcgctgctgg cccgcaggcc ctacagcgtg gtggtcgcgg ccttggccaa caagctggcg       960
     cgcaccgcct gggcggtgct gaccaaaggc aaggcctttg atcagctcag atggaatccg      1020
     gccgctgcgg tggctgcctg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page