(data stored in ACNUC7421 zone)

EMBL: CP000529.PE423

CP000529.PE423       Location/Qualifiers
FT   CDS_pept        444129..444617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3929 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35750"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC2"
FT                   /protein_id="ABM35750.1"
FT                   /translation="MPSGPAGKQACTNRPHIRLQPPLNLYSANACFLGGVHISADYFTN
FT                   HPADTPRITLVRAIKARWACEQAHQQLKDELGLDHYEGRSWLGLHHHALLSMIAFGYLQ
FT                   HRRLASALQAGKKTGIQCTGSPATAVIAGGTPRHHRHASSRDLRSVPSLQRHDRPASA"
     atgccatccg ggccagcagg aaaacaagcc tgcacaaaca ggccgcatat aagactgcaa        60
     cctccgttga acctttactc tgccaatgct tgctttctgg ggggcgtcca tataagcgcg       120
     gactacttca ctaaccaccc ggctgacacg ccgcgcataa cgctggtgcg cgcgatcaag       180
     gcccgctggg catgcgaaca ggcgcatcag caactcaagg acgaacttgg cctggaccat       240
     tacgagggca gatcctggct aggactgcac catcacgcgc tgctgagcat gatcgcattt       300
     ggctatttgc agcaccgacg cctggcgagt gctttacagg cggggaaaaa aaccggcatc       360
     caatgcaccg gatcccccgc cacagccgtc attgccggcg gtacgccgcg ccatcatcgc       420
     catgcttcat cccgtgattt acgttcggtg ccctcactgc agcgccacga tagacctgcg       480
     tcggcgtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page