(data stored in ACNUC7421 zone)

EMBL: CP000529.PE425

CP000529.PE425       Location/Qualifiers
FT   CDS_pept        complement(445572..445871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0430"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   sat:SYN_03173 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35752"
FT                   /db_xref="GOA:A1VJC4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC4"
FT                   /protein_id="ABM35752.1"
FT                   /translation="MSETKKRKVHLPEFKAKVELEALRGVKTINEIAQDFGVHPVQVSQ
FT                   WKKEIQEQAGTLFEGKRGPQPVAAHSAPERLYGEIGRLKMELDWLKKKSGISLP"
     atgagtgaaa cgaagaaacg caaagtccac ctgccggagt tcaaggcgaa ggtcgaactg        60
     gaagccttgc ggggagtcaa gacgatcaat gagattgctc aggacttcgg agttcatccg       120
     gtacaggtca gccagtggaa gaaggaaatc caggagcagg ccggcacgct gttcgagggc       180
     aaacgcggac cacagccggt ggccgcgcac agtgcgccgg agcggctgta tggcgaaatc       240
     ggacgcctga aaatggagct ggactggctc aaaaaaaagt ccgggatcag cctgccatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page