(data stored in ACNUC7421 zone)

EMBL: CP000529.PE444

CP000529.PE444       Location/Qualifiers
FT   CDS_pept        468166..468606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0449"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pol:Bpro_4198 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35771"
FT                   /db_xref="GOA:A1VJE3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE3"
FT                   /protein_id="ABM35771.1"
FT                   /translation="MSDKLILVVEDNPDHLELTVLTLEELGLNAEIAVARDGAAALDYL
FT                   FGQGQHAGRDVRRQPAFVLLDMKLPKLSGLDVLRSVRSNPLTALVPVIMLTSSSEHSDM
FT                   VACYQSGANSFVRKPVDFVDFTEKLNRLQAYWLGVNESLAAV"
     atgtcggata agctgatact tgttgttgaa gacaacccgg accatctgga gctgacagta        60
     ttaacactgg aggagttggg cttgaacgcc gagatcgccg tggcccgcga tggtgccgcg       120
     gcacttgact acctgtttgg ccagggccag cacgccggcc gtgatgtccg tcggcaaccg       180
     gcctttgtcc tgctcgacat gaagctgccc aagctctccg ggcttgacgt cttgcgcagc       240
     gttcgcagca atcccctgac ggcgctggtg ccggtgatca tgctgacttc ttccagtgaa       300
     cattcggaca tggtcgcctg ctaccagagc ggggccaaca gctttgttcg caagcccgtc       360
     gattttgtcg atttcaccga aaaactcaac cgtttgcagg cgtactggct gggtgtgaat       420
     gagtcgctgg cggcggtttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page