(data stored in ACNUC7421 zone)

EMBL: CP000529.PE445

CP000529.PE445       Location/Qualifiers
FT   CDS_pept        468674..472207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0450"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: pol:Bpro_4197 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: GAF
FT                   domain protein; ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35772"
FT                   /db_xref="GOA:A1VJE4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE4"
FT                   /protein_id="ABM35772.1"
FT                   /translation="MKLQTLRKRLVWLLMAAMTPLFGLAILNAQLNADAAVSRATDNLK
FT                   FAVSLAASNQQRMTETVHQLLTAISQVPEIQQGQPASCNRYLGEIKRRLPDYMNLGVVG
FT                   MDGYARCHALAEGSQGAARAFFGDRLYFREAVARRNFFAGEYIVGRITGKPSVTFALPV
FT                   LDVQGRVSFVAYAALDLSSMARSIAAIELPAGAKLGIHDRYGTLLAGTGGIPIAIGQKA
FT                   ASPVLQEAVRTLETGVREGLDARGQHQLWAFMPSSSQADTAFFVAVGMDRSTILEPSRR
FT                   QMWLELAALALVAFLGGWMAWVLGSRAIVKPSADILEATRQLQQGRLDVRIPTQSVHAS
FT                   QELMQIAVGFNRMAESVQAHQAALESELASSQAARERLKDAQSLARIGYWQIDLATQQI
FT                   SWSDEVYELFDIDRTQLDGTYQSFLNWIHPSDREAFTVVRDAAVRAGTALDCEFRVIAP
FT                   GGRICWIHQFGRVHFNPDGRASTQRTGVIQDITQRKLAEQALIDSEQRYAELLEMVPLP
FT                   MWVYDSATTRFLAVNQAAVQAYGYSAAEFLSMTIFDIRPEAEHAYLRQWLDNPLRKKAL
FT                   WHDLRKDASLFSVETVSQPIQYVGRAARLVIAMDKTAQDKAEKETQDYLFTLQRAADAA
FT                   QAITWHQTLEGTMQEIADQARGVIGTHQAVVSLSVDGNPLQMTHALSLSEKYEPYRSLI
FT                   KPADGSDIQAVVSESNRLMRMTQAELEAHPRWPGFGGHGGKHPPMRGWLAVPLIGKNGK
FT                   NIGLLQLSDKYEGEFTKQDEYVALELSHLASAGLENSRLLEEISQLNAGLEQKVAERTV
FT                   ALARQEALFRALAEQAPQLVWTASPDGEATYFNRAWFDLMGGKLEDWTGLQWLAVIHPD
FT                   DVSDIQASWKIARASQSSYAGVRRLLAEDGSCHTMAYRGSPVLDEQGKVAFWVGIDADI
FT                   TEIKAIEAALRLSNQELEAFSYSVSHDLRSPLNTIDGFSRLLAKQLAQQLEGEADAKVT
FT                   HYLARIQAGVAQMGQLIEDLLSLSQVTRASLHTERVDLSFMARSLLDEWQTRQPERQVT
FT                   VTVESGLQAQGDRPLVRIVMENLLANAWKFTSQTAQANISVGQTFDAAGLPVFFVRDNG
FT                   AGFDMAYSDKLFDPFQRLHAASEFSGTGIGLATVSRVIKRHGGRIWAESAPACGATFFF
FT                   TLPQGEAYDAS"
     atgaaattgc agaccctgcg caagcgcctt gtctggctgt tgatggccgc catgacaccg        60
     ttgtttggcc tggccattct caacgcccag ttgaacgcag atgcggccgt cagccgggcc       120
     actgacaacc tgaagttcgc ggtctcgctg gccgcctcga accagcagcg gatgaccgag       180
     acggtgcatc agctgttgac cgccatcagc caggttcccg agatccagca gggccagccg       240
     gcgtcctgca accgttacct tggtgagatc aagcggcgct tgcccgacta catgaacctc       300
     ggtgttgtcg gcatggatgg ctatgcgcgc tgccacgcac tcgcggaagg ttcccagggc       360
     gctgcgcggg cgttttttgg tgatcgcctg tattttcgtg aagccgtcgc ccggcgcaat       420
     ttttttgccg gcgagtacat cgtgggacgc attacgggaa aaccttccgt gacgtttgcc       480
     ttgccggtgc tcgacgtgca aggccgtgtt tccttcgtgg cctatgccgc gctcgacctg       540
     tccagcatgg ccaggtcaat cgccgccatc gagttgccag ccggggccaa gctgggaatc       600
     catgaccgat atggcacctt gctggccggg accggcggca ttcccatcgc cattggacaa       660
     aaggccgcca gcccggttct gcaggaagcg gtcagaacgc tggaaaccgg ggtgcgcgag       720
     ggcctggatg ctcggggcca gcatcagctc tgggccttca tgcccagcag ttcccaagcc       780
     gacaccgcct ttttcgtggc ggtcggcatg gaccgcagca cgattctgga gcccagccgg       840
     cgccagatgt ggctggaact ggctgcgctg gcgctggtgg ctttcttggg cggatggatg       900
     gcctgggtac tgggcagccg tgccattgtg aagccctccg ctgacattct tgaggccacc       960
     cggcaactcc agcagggccg gcttgatgta cgcatcccga ctcaatcggt gcatgccagc      1020
     caggagctga tgcagatcgc cgtcggcttc aaccgcatgg ccgagtccgt gcaggcgcat      1080
     caggcggcac ttgagtctga actggccagc agccaggctg cccgggagag gctgaaggac      1140
     gcgcaaagcc ttgcgcgcat cggctactgg cagattgatc ttgcaaccca gcagatttcc      1200
     tggtctgacg aggtttacga gttgttcgac atcgaccgta cccagcttga cggcacttac      1260
     cagagctttc tcaactggat tcatccgtct gaccgtgagg ctttcacggt ggtccgcgat      1320
     gctgcggttc gggccggaac cgcgctggat tgcgagttcc gcgtcatcgc gccagggggg      1380
     cggatttgct ggattcatca gtttggccgg gttcatttca accccgatgg gcgtgcatca      1440
     acgcagcgca ccggggtgat tcaggacatc acgcagcgca agcttgccga acaggcgctc      1500
     atcgacagtg agcagcgcta tgcggaactg ctggaaatgg tgccccttcc gatgtgggtg      1560
     tacgacagcg ccacgacacg cttcctggcg gtgaaccagg cggcggtcca ggcctatggc      1620
     tattcggctg cggaattcct gtcgatgacg atttttgaca ttcggcccga ggctgaacat      1680
     gcgtacctgc gccagtggct ggacaatccg ttacgaaaaa aggccttgtg gcacgatctg      1740
     cgcaaggatg cctccctgtt ttcggtcgag accgtgtcgc agccgattca gtatgtcggc      1800
     cgggcggcgc gccttgtcat cgccatggac aaaacggccc aggacaaggc cgaaaaggaa      1860
     acccaggact acctgttcac attgcagcgc gcggcagacg cagcccaggc catcacctgg      1920
     caccagacgc tggaaggcac gatgcaggag attgccgacc aggcgcgcgg cgtgattggc      1980
     acgcaccagg cggtggtgag cctgagcgtg gacggcaatc ccttgcaaat gacgcatgcg      2040
     ctgtcactgt ctgaaaaata tgaaccctac cgcagcctga taaaaccggc tgacggcagc      2100
     gacatccagg ccgtggtgag cgagagcaac cgtttgatgc gcatgaccca ggccgagctt      2160
     gaggcacatc ctcgctggcc tggctttggc ggccatgggg gcaaacatcc gcctatgcgt      2220
     ggctggctgg cggtgcccct gattggaaaa aatggaaaaa acatcggcct gctccagctg      2280
     tccgacaagt acgagggcga gttcaccaag caggatgaat atgtggcgct ggaactgagc      2340
     cacctggcct ccgccggcct ggaaaactca agactcctgg aagaaatcag ccagctgaat      2400
     gccggcctgg agcaaaaagt ggccgagcgt accgttgcgc tggcgcgtca ggaagccctg      2460
     ttccgggcat tggccgagca ggcgccgcag ctggtgtgga ccgccagccc cgacggggag      2520
     gccacctatt tcaaccgcgc atggttcgac ctcatgggcg gaaaacttga ggactggacc      2580
     ggcttgcagt ggcttgcggt cattcatcct gacgatgtgt ccgacatcca ggccagctgg      2640
     aaaatcgcca gggccagcca gtcctcttac gcaggcgtgc ggcgcctgct ggccgaagat      2700
     ggcagttgcc acaccatggc ctaccgaggc tcgccggtgc ttgacgagca gggcaaggtc      2760
     gccttctggg taggcattga tgccgacatc acggagatca aggccatcga ggcggccttg      2820
     cgcctgtcca accaggaact cgaagctttt tcttattccg tctcgcatga ccttcgctcg      2880
     ccgctcaaca ccattgacgg cttcagccgc ttgctggcca agcaactggc gcagcaactg      2940
     gagggggagg cggacgcgaa ggtcacgcac tacctggcgc gcatccaggc gggcgtggcc      3000
     cagatggggc aattgatcga ggatttgctg tccctgtcgc aggtcacgcg cgccagcttg      3060
     cataccgaac gggtcgatct gtcgttcatg gcccgcagcc ttctggatga atggcaaacc      3120
     cgccagcccg agcgccaggt cacggtgacc gtggaaagcg gcttgcaggc gcagggtgac      3180
     aggccgcttg tcaggatagt gatggaaaac ctgctggcca acgcctggaa attcacctcg      3240
     caaacagcac aggccaacat cagcgtgggt caaacattcg atgcggccgg gttgccggta      3300
     ttttttgtca gggataacgg cgcgggcttt gacatggctt attcagacaa gctgtttgac      3360
     cctttccagc gcttgcatgc ggcttccgag ttttcaggaa ccggcatcgg gctggcaacc      3420
     gtcagccgcg tcatcaagcg gcatggcggg cgcatatggg ctgagtcagc gcctgcctgt      3480
     ggcgccactt tcttttttac gctgccccag ggggaggcat atgacgcaag ttga            3534
//

If you have problems or comments...

PBIL Back to PBIL home page