(data stored in ACNUC7421 zone)

EMBL: CP000529.PE447

CP000529.PE447       Location/Qualifiers
FT   CDS_pept        472986..474545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0452"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pol:Bpro_4195 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35774"
FT                   /db_xref="GOA:A1VJE6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE6"
FT                   /protein_id="ABM35774.1"
FT                   /translation="MSRFLDKFRLTPAGNLPDVSLQSANSSLPAAQPEWGPLDLTLDGI
FT                   VLLDDKAVILDANAPALEFLHTSLSAISGYSLWDVVPEEVAKQNEEATELALDSADRHS
FT                   FIAHESFENSWVEYTFRRCPAGYVVNLREAGPAQKYQRLLEDSKRYNQLIFEANPNVMW
FT                   VFDRTTLRIFAVNQAAVKFYGIARKIFMTLGMEALFPQGEGAELLRSLHTGKEEQSEMR
FT                   LCKQKKMDGKEVLVELAWSQVKWDGHQAVLVSLADISDRHLADGVLKKTNEELQKTLVA
FT                   QQVELKNVRHDLLTFTQAVSSDLQDSLHAAHGFAARLAEKYSLALDDQGRHYVRRIQAS
FT                   ISQLAKLVDDLRTLAQLPLRSGVPAMVNLAPVCLSLIADLRKRDPDRDVTIEMDSKLML
FT                   VGNKGLLTTAMTCLLENAWKFTSKKTEAWIKVGLLPGKAPGELVLLVADNGAGFDPVYS
FT                   GNLFTAFQRLHSSADFPGNGLGLAIIKRVAQVHGGTVWAESPGQGGASFFMSLPQGEAS
FT                   AS"
     atgagccgat ttctggacaa gttccggttg acccccgcag gtaacttgcc cgacgtgagc        60
     ttgcagagcg ccaattccag cctgccggca gcgcagccag aatggggacc cctggacctg       120
     accctcgatg gcatcgtgct tcttgacgac aaagccgtca tccttgacgc caatgctccg       180
     gcgcttgagt tcctgcacac ctcgctgtcc gccatcagcg gctacagctt gtgggacgtg       240
     gtgcccgagg aagttgccaa gcagaatgaa gaggccaccg aactggctct ggattctgcg       300
     gaccggcata gctttattgc ccatgagagt tttgaaaaca gttgggtcga atacaccttc       360
     aggcgatgcc cggcaggtta cgtcgtcaac ctgcgcgaag cgggtccggc ccaaaaatac       420
     cagcgcctgc tggaagacag caaacgctac aaccagctga tttttgaagc caatccgaat       480
     gtcatgtggg tctttgaccg gaccacgctt cgaatctttg ccgtcaacca ggctgccgtc       540
     aagttttacg gcattgcccg caagattttc atgacgcttg gcatggaagc gctctttccc       600
     cagggagaag gcgccgaact gctgcgctcc ctgcacaccg gcaaggaaga gcagtctgaa       660
     atgcggctgt gcaaacagaa aaaaatggac ggcaaggaag tgctggttga gctggcctgg       720
     agccaggtca agtgggatgg ccatcaggcg gtgctggtga gcctggccga catcagtgac       780
     cggcacctcg ctgacggcgt cctgaaaaaa accaatgagg aattgcaaaa gacactcgtc       840
     gcccagcagg tcgaactgaa aaatgtccgg catgacctgc tcacctttac ccaggccgtc       900
     tccagtgact tgcaggactc cctgcatgcg gcccatggct ttgccgccag gctggctgaa       960
     aagtattcgc tggcgctgga cgaccagggc cgccactatg tcaggcgcat tcaggccagc      1020
     atcagccagt tggccaagct ggtcgatgac ctgcgaacac tcgcccagct gccgctgcgc      1080
     tccggagttc ctgcaatggt caatctggca ccggtctgcc tttcattgat cgctgatttg      1140
     cgcaagcgcg acccggaccg ggatgtgacc atcgaaatgg acagcaagct gatgctggtc      1200
     gggaacaagg ggcttttgac gacagccatg acctgcctgc tggaaaatgc ctggaaattc      1260
     acctccaaaa agaccgaggc atggatcaag gtcgggctgc tgcccggcaa ggcgccgggt      1320
     gagctggtgt tgctggtggc cgataatggc gccggatttg atccggttta cagcggcaat      1380
     cttttcaccg cgtttcagcg cctgcactct tcagccgact ttccgggcaa cgggctgggg      1440
     ctggccatca tcaagcgggt tgcgcaggtg catggcggca cggtatgggc tgaaagtccg      1500
     ggccaggggg gggccagttt tttcatgtcg cttccgcaag gggaagccag cgcttcctga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page