(data stored in ACNUC7421 zone)

EMBL: CP000529.PE448

CP000529.PE448       Location/Qualifiers
FT   CDS_pept        474767..475162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0453"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: pol:Bpro_4192
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35775"
FT                   /db_xref="GOA:A1VJE7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE7"
FT                   /protein_id="ABM35775.1"
FT                   /translation="MATTYTISDLAKEFDLTTRAMRFYEDMGLLQPEREGPGGRNRVYS
FT                   ARDRTRLKLTLRAKRLGLSLTEAKEIIDSYDSPRDTAPQLKKFLAILADHRKKLEDQLV
FT                   DLQANLDEIRTHEKEARVLLLKAEKLK"
     atggccacta cctacaccat cagcgacctc gccaaagagt ttgacctgac cacccgcgcc        60
     atgcgctttt acgaggacat ggggctgctg cagcccgagc gcgaagggcc gggcggtcgc       120
     aaccgcgtgt attcggcgcg cgaccgcacg cggctcaagc tcacgctgcg ggccaagcgc       180
     ctggggctgt cgctcaccga ggccaaggaa atcatcgatt cctatgacag tccgcgcgac       240
     acggctccgc agctgaagaa attcctggcc attttggccg accaccgcaa gaagctcgaa       300
     gaccagctgg tggacttgca ggccaatctg gatgaaattc gcacccacga aaaagaagcc       360
     cgggtgctgc tgctcaaagc tgagaaatta aaatag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page