(data stored in ACNUC7421 zone)

EMBL: CP000529.PE45

CP000529.PE45        Location/Qualifiers
FT   CDS_pept        complement(46453..46962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0046"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /note="TIGRFAM: carbohydrate kinase, thermoresistant
FT                   glucokinase family; PFAM: shikimate kinase; KEGG:
FT                   rfr:Rfer_0956 carbohydrate kinase, thermoresistant
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35372"
FT                   /db_xref="GOA:A1VI94"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI94"
FT                   /protein_id="ABM35372.1"
FT                   /translation="MTDSLVIMGVAGCGKSSLGAAVAQATGLALVEGDDFHSEASRAKM
FT                   SQGIALLDADRDGWLGVLGEQLRAHPEGLVLTCSALKLSYRERLRQAAPGLRFVFLDIS
FT                   REQAQARVAARAAQHFFSTTLVDSQFATLEAPTGEAGVLRVDALKSLDQLQAEVTEWLT
FT                   AKKEQA"
     atgacagatt ccctcgtgat catgggtgtg gccggttgcg gcaagtccag cctgggcgcc        60
     gccgtggcgc aggccaccgg cctggcattg gtcgaaggcg acgacttcca cagcgaagcc       120
     agccgcgcca agatgagcca gggcatcgcc ctgctggatg ccgaccgcga cggctggctg       180
     ggcgtgctgg gcgagcagct gcgcgcccac cccgaaggcc tggtgctgac ctgctcggcg       240
     ctgaaacttt cctaccgcga gcgcctgcgc caggccgcgc ccggcctgcg cttcgtgttc       300
     ctggacatca gccgcgaaca ggcgcaggcc cgggtggcgg cgcgcgccgc gcagcatttc       360
     ttctcgacca cgctggtgga cagccagttc gccacgctcg aagcgcccac gggcgaagcg       420
     ggcgtgctgc gcgtcgatgc gctcaaatcg ctggaccagc tgcaggccga agtcactgaa       480
     tggctcaccg ccaaaaagga gcaggcatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page