(data stored in ACNUC7421 zone)

EMBL: CP000529.PE450

CP000529.PE450       Location/Qualifiers
FT   CDS_pept        475729..476910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0455"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_4190 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35777"
FT                   /db_xref="GOA:A1VJE9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE9"
FT                   /protein_id="ABM35777.1"
FT                   /translation="MNNMPGLNFQLGEDIDALRDAVRDFAQAEIAPRATEIDKSDQFPM
FT                   DLWEKMGALGVLGITVGEEYGGAGMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   KRNGSEAQRQKYLPKLISGEHVGALAMSEPGAGSDVISMKLKAEDKGGYYLLNGSKMWI
FT                   TNGPDADTLVVYAKTEPELGARGVTAFLIEKGMPGFSVAQKLDKLGMRGSHTGELVFQN
FT                   VEVPEQNILGNLNGGAKVLMSGLDYERAVLTGGPLGIMQSVMDNVLPYIHDRKQFGQSI
FT                   GEFQLIQGKVADMYTVLQAGRSFAYTVAKNLDMLGTDHVRQVRKDCASVILWCAEKATW
FT                   MAGEGIQIYGGNGYINEYPLGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETC"
     atgaacaaca tgcccggact caactttcaa ctcggcgaag acatcgacgc cctgcgcgac        60
     gcggtgcgcg actttgccca ggccgaaatc gcgccgcgcg ccaccgagat tgacaagagc       120
     gaccagttcc cgatggacct gtgggaaaag atgggcgcgc tgggcgtgct cggcatcacg       180
     gtgggcgagg aatacggcgg cgccggcatg ggctacctgg cgcacatgat cgcgatggaa       240
     gaaatcagcc gcgccagcgc ctcggtcggc ctgtcgtatg gcgcgcactc caacctgtgc       300
     gtcaaccaga tcaagcgcaa cggcagcgag gcgcagcgcc agaaatacct gcccaagctg       360
     atttccggcg agcatgttgg cgcgctggcc atgagcgagc cgggcgcggg cagcgatgtg       420
     atctcgatga agctcaaggc cgaggacaag ggcggttatt acctgctcaa cggcagcaag       480
     atgtggatca ccaacggccc cgacgccgac acgctggtgg tctatgccaa gaccgagcct       540
     gaactgggcg cgcgcggcgt gaccgccttc ctgatcgaaa aaggcatgcc cgggttttcc       600
     gtcgcgcaaa agctcgacaa gctcggcatg cgcggcagcc acaccggcga gctggtgttc       660
     cagaacgtcg aagtgcccga gcagaacatc ctgggcaacc tgaacggcgg cgcgaaggtt       720
     ctcatgagcg gcctcgacta cgagcgcgcc gtgctgaccg gcggaccgct cgggatcatg       780
     cagtcggtga tggacaacgt gctgccctac atccacgacc gcaagcagtt cggccagagc       840
     atcggcgagt tccagctgat ccagggcaag gtcgccgaca tgtacaccgt gctgcaggcc       900
     gggcgctcgt ttgcctacac cgtggccaag aacctggaca tgctgggcac ggaccatgtg       960
     cgccaggtgc gcaaggactg tgcctcggtg attttgtggt gcgccgaaaa agccacctgg      1020
     atggccggcg aaggcatcca gatttacggc ggcaacggct acatcaatga atatccgctc      1080
     ggccgcctgt ggcgcgatgc caagctctac gaaatcggcg ccggcaccag cgaaatccgc      1140
     cgcatgctga ttggccgcga actgttcgcc gaaacctgct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page