(data stored in ACNUC7421 zone)

EMBL: CP000529.PE452

CP000529.PE452       Location/Qualifiers
FT   CDS_pept        477701..479572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0457"
FT                   /product="Isocitrate dehydrogenase kinasephosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: pol:Bpro_4188 (isocitrate dehydrogenase (NADP+))
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35779"
FT                   /db_xref="GOA:A1VJF1"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJF1"
FT                   /protein_id="ABM35779.1"
FT                   /translation="MFPQRLDSTVAYAIAKAMIDGFNRHYRLFRTESARAKHRFETADW
FT                   HGQQRAQRERIEFYDLRVREASIRLEREFKAGEQPMDVWHQVKLHYIGLLVNHHQPELA
FT                   ETFFNSVTTKILHRSYFQNDFIFVRPAVSTEYIENQEPTAQPTYRAYYPTQGNMHETLV
FT                   KLVEDFGLCREFEDLRRDAGYVAEAMAARLGDVKLRANFQIQVLSGLFFRNKGAYVVGK
FT                   IINGFGEIPFALPILHRQPAPGQVLPADGKGISSQSDAGKLVIDAALFGEDDLLILFSF
FT                   ARAYFMVDMGIPSAFVQFLRSMMPRMPRAEIYNALGLAKQGKTLFYRDFLHHLRHSTDK
FT                   FRIAPGIKGMVMLVFDLPSFPYVFKVIKDYYPPQKDTTREQIKGKYLLVKQHDRVGRMA
FT                   DTQEYSEVAFPRERFSDELIAEIEKFAPSQLEISDRDGDGQMEVIIKHVYIERRMIPLN
FT                   IYLQEAFDFGVAEPAARDQIERAVVEYGNAIKDMVAANIFPGDMLWKNFGITRHGKVVF
FT                   YDYDEIEYITDCKFRKVPTPRNEEDEMSGEVWYSVGPKDVFPETFGPFLLGNDAVREVF
FT                   MKHHADLLDAAFWQRHQARIQAGHVYDVFPYDQQKRFAVMHGPARAG"
     atgttcccgc aacgccttga ctccaccgtg gcctacgcca tcgccaaggc gatgatcgac        60
     ggcttcaacc gccactaccg gctgttccgc accgaatcgg cgcgcgccaa gcaccgcttc       120
     gagaccgccg actggcacgg ccagcagcgc gcccagcgcg agcgcatcga gttctacgac       180
     ctgcgcgtgc gcgaagcctc gatccggctg gagcgcgagt tcaaggcggg cgagcagccg       240
     atggatgtct ggcaccaggt caagctgcat tacatcggcc tgctggtcaa ccaccaccag       300
     cccgaactgg ccgagacctt tttcaactcg gtcaccacca aaatcctgca ccgcagctat       360
     ttccagaacg atttcatctt tgtgcggccc gccgtcagca ccgagtacat cgaaaaccag       420
     gaaccgaccg cgcagccgac ctaccgggcc tactacccga cgcagggcaa catgcacgag       480
     acgctcgtca agctggtcga agactttggc ctgtgccgcg agtttgaaga cctgcggcgc       540
     gatgccggct acgttgccga ggccatggcc gcgcgcctgg gcgacgtgaa gctgcgcgcc       600
     aatttccaga tccaggtgct gtccgggctg ttctttcgca acaagggtgc ctacgtcgtc       660
     ggcaagatca tcaacggctt tggcgaaatt ccctttgccc tgccgatttt gcaccgccag       720
     ccggcgccgg ggcaggtgct gcccgccgac ggtaagggca tctccagcca gtcggatgcc       780
     ggcaagctgg tgattgacgc ggccctgttc ggcgaggacg acctgctgat cctgttcagc       840
     tttgcgcgcg cctatttcat ggtcgatatg ggcattccgt cggcgttcgt gcagtttttg       900
     cgcagcatga tgccgcgcat gccgcgcgcc gagatctaca acgcgctggg cctggccaag       960
     cagggcaaga cgctgttcta ccgcgacttt ctgcaccacc tgcgccactc gaccgacaaa      1020
     ttccgcatcg cgcccggcat caagggcatg gtcatgctgg tgttcgattt accctcgttc      1080
     ccgtatgtgt tcaaggtcat caaggactac tacccgccgc aaaaagacac cacgcgcgag      1140
     cagatcaagg gcaagtattt gctggtcaag cagcacgacc gcgtgggccg catggccgac      1200
     acgcaggagt acagcgaggt cgcctttccg cgcgagcgct tcagcgacga gctgatcgcc      1260
     gagatcgaga agttcgcccc cagccagctg gagatcagcg accgcgacgg cgacggccag      1320
     atggaagtca tcatcaagca tgtgtacatc gagcggcgca tgattccgct gaacatctac      1380
     ctgcaggagg cgttcgactt cggcgtggcc gagcccgccg ccagggacca gatcgagcgc      1440
     gccgtggtcg agtacggcaa cgccatcaag gacatggtcg cggcgaatat ctttccgggc      1500
     gacatgctgt ggaaaaactt cggcatcacg cgccacggca aggtcgtgtt ctacgactac      1560
     gacgagatcg aatacatcac cgactgcaag ttccgcaagg tgcccacgcc gcgcaacgag      1620
     gaagacgaaa tgagcggcga agtctggtat tcggtcggac ccaaggacgt gttccccgag      1680
     accttcggcc catttttgct cggcaacgat gcggtgcgcg aagtcttcat gaagcaccat      1740
     gccgacctgc tcgatgccgc cttctggcag cgccaccagg cgcgcatcca ggccggccat      1800
     gtgtacgacg tgtttccgta tgaccagcaa aagcgcttcg cggtcatgca cggcccggcg      1860
     cgcgccggtt ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page