(data stored in ACNUC7421 zone)

EMBL: CP000529.PE454

CP000529.PE454       Location/Qualifiers
FT   CDS_pept        480874..482004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0459"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_4185 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35781"
FT                   /db_xref="GOA:A1VJF3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF3"
FT                   /protein_id="ABM35781.1"
FT                   /translation="MILNDDQEQVRDAVRAFAQAELWPHAARWDKEHYFPKEAHKGLAA
FT                   LGAYGICVPEEFGGANLDYVTLALVLEEIAAGDGGTSTAISVTNCPVNAILMRYGNPAQ
FT                   KKQWLMPLAQGDLLGAFCLTEPHTGSDASSLRTTAVKDGDGYVLSGVKQFITSGQNGQV
FT                   AIVIAVTDKGAGKKGMSAFIVPTDAPGYSASRLEDKLGQHSSDTAQVNFDNCRIPAENL
FT                   IGAEGEGYKIALGGLEGGRIGIAAQSVGMARSAFEVAVAYAKERQSFGSAIFNHQAVGF
FT                   RLADCATQLEAARQLIWHAASLRDAGRPCLKEAAMAKLFASEMAEKVCSAAIQTLGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDVQKIIIQRALA"
     ttgatactca atgacgacca ggaacaggtg cgcgatgcgg ttcgcgcctt tgcgcaggcc        60
     gaactctggc cgcatgccgc gcgctgggac aaggagcatt actttccgaa agaagcgcac       120
     aaggggctgg ccgcgctcgg cgcctacggc atctgcgtgc ccgaggaatt cggcggcgcc       180
     aacctcgact acgtgacgct ggcgctggtg ctcgaagaaa tcgccgctgg cgacggcggc       240
     accagcaccg ccatcagcgt gaccaactgt ccggtcaatg ccatcctgat gcgctacggc       300
     aacccagcgc agaaaaagca gtggctcatg ccgctggcgc agggcgatct gttgggcgcg       360
     ttctgcctga ccgagccgca caccggcagc gatgcttcgt cactgcgaac cacggccgtg       420
     aaagacggcg acggctatgt gctgagcggc gtcaagcagt tcatcaccag cggccagaac       480
     ggtcaggtcg ccatcgtcat cgctgtcacc gacaagggcg ccggcaagaa gggcatgagc       540
     gccttcatcg tgccgaccga tgcgcccggc tattcagcct ccaggctcga agacaagctg       600
     ggccagcatt cgagtgacac cgcgcaggtc aacttcgaca actgccgcat cccggccgag       660
     aacctgatcg gcgccgaagg cgaaggctac aagatcgccc tgggcgggtt agagggcggg       720
     cgcatcggca ttgccgcgca aagcgtcggc atggcgcgca gcgcgttcga ggtggccgtg       780
     gcctatgcca aggagcgcca gagttttggc agcgcgatct tcaaccacca ggcggtcggt       840
     ttccggctgg ccgactgcgc gacccagctt gaagcggccc gccagctgat ctggcacgca       900
     gccagcctgc gcgacgcggg acggccctgc ctgaaggaag cggcgatggc caagctgttc       960
     gccagcgaga tggctgagaa agtctgcagc gccgccatcc agacgctggg cggctacggt      1020
     tatgtgagcg acttcccggt cgagcgcatc taccgcgacg tgcgcgtgtg ccagatctac      1080
     gaaggcacga gcgatgtgca gaagatcatc atccagcgcg cgctggcttg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page