(data stored in ACNUC7421 zone)

EMBL: CP000529.PE459

CP000529.PE459       Location/Qualifiers
FT   CDS_pept        complement(485332..485946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0464"
FT                   /product="protein of unknown function DUF1326"
FT                   /note="PFAM: protein of unknown function DUF1326; KEGG:
FT                   mlo:mll4476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35786"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF8"
FT                   /protein_id="ABM35786.1"
FT                   /translation="MSSWQITGQYMETCNCAFLCPCITSNLTARPTEGDCKAAVTMHID
FT                   KGAKDGIALDGLSFVLILHSPGPMGEGNMTVGLIVDNTASDQQLEAISAIASGSAGGPM
FT                   AALAPLVSTNAGVERRPIRFEVDGLNYAMSAGELVDQACEGLPSVTDPEQAIGIDNTAH
FT                   PVNSRLSLAKAKRSRFHAFGIDWEDATGTRNGHFAPFAWAG"
     atgtctagct ggcaaatcac cggtcaatac atggagacct gcaattgcgc atttctttgc        60
     ccttgcatta cctccaacct cacggcacgg ccgaccgaag gcgactgcaa ggctgcggtc       120
     accatgcaca tcgacaaagg cgcgaaggac ggcattgccc ttgatgggct gtcgttcgtt       180
     ttgatcttgc attcgccagg ccccatgggc gaaggcaaca tgacagtcgg gctgatcgtc       240
     gataacaccg cttcggatca acagcttgag gccatcagcg ccatcgccag cggctcggct       300
     ggcggcccga tggcagcact ggcaccactc gtcagcacga atgcaggcgt cgagcggcgg       360
     cccatccggt tcgaggtcga cgggctgaat tacgccatga gcgcaggcga gttggtggac       420
     caggcttgcg aagggctccc gagcgtcacc gatcccgaac aggccatcgg catcgacaac       480
     accgcgcatc ccgtcaatag ccggctgtct ctcgccaagg caaagcgcag ccgctttcac       540
     gctttcggca tcgactggga ggacgcaacc ggcacgcgca acggccactt tgcgcccttc       600
     gcctgggcgg gttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page