(data stored in ACNUC7421 zone)

EMBL: CP000529.PE46

CP000529.PE46        Location/Qualifiers
FT   CDS_pept        47101..48171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0047"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: rfr:Rfer_0957
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35373"
FT                   /db_xref="GOA:A1VI95"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI95"
FT                   /protein_id="ABM35373.1"
FT                   /translation="MRASAPYHSVVSLGFMTPARLRPRATGRVTLTDVAQAAGVSPITV
FT                   SRALRGERAVDPALVERVQAAARSLGYVPDPAARALASQRSSHVAVLIPMLSNALFVDL
FT                   LEAVQRSLRPAGYQTLMGVTHYNADEEEQLLREQLLQRPAGLVVTGLERSDAARALIAQ
FT                   SGVPCVHVMEMSSVPGVYSVGFSQADAGAELTRHLLARGRRRIAFVAAQLDARTLQRLE
FT                   GWRRELLAAGLHDPALEWLDPAPSSIALGARLFERIIGEQPDVDAVFFCNDDLAQGALL
FT                   AALRLGVAVPERVAVAGFNDLTGSDQMLPPLTTVRTPRSEIGHAAARMLLALMNGETVA
FT                   SPCVDLGYELVVRAST"
     atgcgagcat cagcccctta ccactcagta gtttccctag gattcatgac accagcccgc        60
     cttcgccccc gcgccaccgg ccgcgttacc ctgaccgacg tggcgcaagc cgccggcgtc       120
     agcccgatca ccgtgtcgcg cgcgctgcgc ggcgagcgcg ccgtcgatcc ggcgctggtc       180
     gagcgcgtgc aggcggcggc gcgctcgctg ggttatgtgc ccgacccggc ggcgcgcgcg       240
     ctggcgtcgc agcgcagctc gcacgtcgcg gtgctgattc cgatgctgtc gaacgccttg       300
     ttcgtcgatc tgctcgaagc cgtgcagcgc agcctgcgcc cggccggcta ccagacgctg       360
     atgggcgtga cgcactacaa cgccgacgag gaggagcaac tgctgcgcga gcaactgctg       420
     cagcgcccgg ctggcctggt cgtgaccggg cttgaacgca gcgacgccgc gcgcgcgctg       480
     attgcgcaaa gcggcgtgcc ctgcgtgcat gtgatggaaa tgtccagcgt gcccggcgtg       540
     tacagcgtcg gcttttcgca ggccgatgcg ggggccgaac tgacgcggca tttgctggcg       600
     cgcggccgcc ggcgcatcgc cttcgtggcc gcgcagctcg atgcgcgaac gctgcagcgg       660
     ctcgaaggct ggcgccgcga actgctggct gccggcttgc acgatccggc gctcgaatgg       720
     ctggacccgg cgccgtcatc gattgcgctg ggcgcgcgcc tgttcgagcg gatcatcggc       780
     gagcagcccg acgtggacgc ggtgttcttc tgcaatgacg acctggcgca gggcgccttg       840
     ctggcggcgc tgcgcctggg cgttgcggtg ccggagcgcg tggcggtggc cggcttcaac       900
     gacctgaccg gcagcgacca gatgctgccg cccttgacca cggtgcgcac gccgcgcagc       960
     gaaatcggcc acgccgccgc gcgcatgctg ctggcgctga tgaacggcga gaccgtggcc      1020
     tcgccctgcg tcgatctggg ttacgagctg gtggtgcggg ccagcacctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page