(data stored in ACNUC7421 zone)

EMBL: CP000529.PE462

CP000529.PE462       Location/Qualifiers
FT   CDS_pept        487567..488226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0467"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_B1631 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35789"
FT                   /db_xref="GOA:A1VJG1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG1"
FT                   /protein_id="ABM35789.1"
FT                   /translation="MKFEAILFDCDGVLVDSEPITNGVLRDMLEEGGWSLTPAECMRVF
FT                   VGKAVRDERLLIEAKTGQPLTEDWMAEFYARRNRELQARLTAIAGAHEAVAAAHAHVAE
FT                   RIACASGADRFKVEMQLAQVGLMDYFAGRIFSGHEMPRSKPAPDVYLAAAAHLGAAGAR
FT                   CLVIEDTTTGVTAGIAAGATVWAYCPQPEQGAVLRQAGASQLFAHMAELPGLLAAV"
     atgaaattcg aagcaatcct gtttgactgc gacggcgtgc tggtggacag cgaaccgatc        60
     accaacggcg tgctgcgcga catgctcgaa gaaggcggct ggtcgctcac gcctgccgag       120
     tgcatgcggg tgttcgtcgg caaggcggtg cgcgacgagc gcctgctgat cgaagccaaa       180
     accggccagc cactgaccga ggactggatg gccgagttct acgcgcggcg caaccgcgag       240
     ctgcaggcgc gtctgacggc catcgcgggc gcgcacgagg ccgtggcggc ggcgcacgcc       300
     catgtggccg agcgcatcgc ctgcgcgtcg ggcgctgacc gcttcaaggt cgaaatgcag       360
     ctggcgcagg tcgggctgat ggattatttt gcgggccgca tcttcagcgg ccacgagatg       420
     ccgcgctcca agcccgcgcc cgatgtgtac ctggccgctg ccgcgcacct gggcgcggcg       480
     ggtgcgcgct gcctggtgat cgaggacacg acgaccggcg tgacggctgg catcgccgcc       540
     ggggccacgg tctgggcgta ttgcccgcag cctgaacagg gcgcggtctt gaggcaggcc       600
     ggcgcgagcc agctgtttgc gcatatggcc gagttgccgg ggcttttggc cgccgtttga       660
//

If you have problems or comments...

PBIL Back to PBIL home page