(data stored in ACNUC7421 zone)

EMBL: CP000529.PE463

CP000529.PE463       Location/Qualifiers
FT   CDS_pept        complement(488415..488861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0468"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein,; KEGG:
FT                   nha:Nham_1961 ion transport 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35790"
FT                   /db_xref="GOA:A1VJG2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG2"
FT                   /protein_id="ABM35790.1"
FT                   /translation="MVLVIFSCLLLIALTTLMHYEVLSSLNLRLPALAMPSRAKLLVVI
FT                   FAAFMAHALEIALYGFALFGLVQYVGGVGGLTGAGDSSLQNCLYFSAETYSSLGFGDLI
FT                   PNGPIRLLAGVEALNGLLLIGWSASYAYIAMERFWGSGSGDGES"
     atggtccttg tcattttttc ctgcttactg ctgatcgcgc tgacgacgct gatgcattac        60
     gaggtgctga gcagcctcaa cctgcggctg cctgcgctcg ccatgcccag ccgggccaag       120
     ctgctggtgg tgattttcgc ggccttcatg gcccatgcgc tggaaatcgc cctgtacggt       180
     tttgcgctgt tcggcctggt gcagtacgtc ggcggcgtcg gcggcctgac gggcgcgggc       240
     gactcgtcac tgcagaactg cctttacttt tcagccgaaa cctattcatc gctcggcttc       300
     ggcgacctga tcccgaacgg cccgatccgg ctgctggccg gcgtcgaggc gctgaacggc       360
     ctgctgctga tcggctggtc ggcctcttat gcctatatcg cgatggagcg tttctggggc       420
     agcggcagcg gggatggcga gtcctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page