(data stored in ACNUC7421 zone)

EMBL: CP000529.PE469

CP000529.PE469       Location/Qualifiers
FT   CDS_pept        494747..495418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0474"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_4158 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35796"
FT                   /db_xref="GOA:A1VJG8"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG8"
FT                   /protein_id="ABM35796.1"
FT                   /translation="MQALDTAQLIALAGALGWASGVRLYLVMLLTGLAGYMGWMELPQG
FT                   LHLLANPVVLGASGFMVFVEFFADKIPGLDSLWDVVHTVIRIPAGAALAAGVFGADSSA
FT                   MGLAAALVGGTLAATSHAAKATSRAAINTSPEPFTNIGTSLVEDSLVPAGLWLAIAHPL
FT                   VFIPLLALVLVLSIWLIRLCWRFLTQLFARVARIFSGKPDAGLPPAFTLKSPFSKNDPH
FT                   V"
     atgcaagccc tggacaccgc tcaactgatc gctttggctg gcgccctggg ctgggccagc        60
     ggcgtgcgcc tgtatctggt gatgctgctg accgggctgg ccggctacat gggctggatg       120
     gagctgccgc agggcctgca cctgctggcc aatccggtgg tgctgggcgc cagcggcttc       180
     atggtgtttg tcgagttctt cgccgacaag attccgggcc tcgattcgct ctgggacgtg       240
     gtgcataccg tgatccgcat cccggccggc gctgccctgg cggcgggcgt ttttggcgcc       300
     gacagcagcg cgatggggct ggcagccgcc ctggtcggcg gcacgctggc cgcgaccagc       360
     catgcggcca aggccaccag ccgcgccgcc atcaacacct ctcccgagcc gttcaccaac       420
     atcggcacct cgctggtcga ggacagcctg gttccggcgg ggctgtggct ggcgattgcg       480
     catccccttg tcttcattcc cttgctggcg ctggtgctgg tgctcagcat ctggctgatc       540
     cgtctttgct ggcgcttttt gacccagctg tttgcccgcg tggcgcgtat tttcagcggc       600
     aagcccgatg ccggattgcc gcccgctttt accctgaagt cccctttttc aaagaacgac       660
     ccccatgttt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page