(data stored in ACNUC7421 zone)

EMBL: CP000529.PE475

CP000529.PE475       Location/Qualifiers
FT   CDS_pept        500800..502626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0480"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294,
FT                   nucleotidyltransferase putative; KEGG: cvi:CV2945 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35802"
FT                   /db_xref="GOA:A1VJH4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH4"
FT                   /protein_id="ABM35802.1"
FT                   /translation="MPSAFNFSASPFDCLTPDEQQLVQDSVDIAYFPQGATILAPGAQP
FT                   THLFVIIKGFVQQFDGNDVVTTYGPEDCFDGRGLMAGKVSSRFVAAEEVVAYQLARQAV
FT                   SDLIAGNVTFGALLFSDLSNKLSALSERQSRHELQSLTMARVDEAFVRTPHFVDADMSI
FT                   LDVTRQFHSLRTATLLVRDSQVSPPALGIFTLTGLQRAILDGTPLDRLAVRGLTNFSLI
FT                   KVRPSDQLGDALAVMIKHKVHRVVVAEGEHITGVLEALDLFSFLSNHSYLINVQILDAR
FT                   DVPALQEAAGQITRLISLLQRSGTHINMIARLVQELNAKLFERAWQLIAPPDLVANSCL
FT                   FVMGSEGRGEQLLKTDQDNGLVLRDGYEPACDVAAVCRRFSAALADFGYPPCPGNIMVS
FT                   NPQWCQSVTDFSQTARLWLMAATTDGLMALAIFLDAHAVCGDRTLLDKVRAAVYDMTAD
FT                   NDAMLARFASAINAFGNSSAWWNRLLFRGDQGKEALDIKKAGTFPLVHGVRSLALAHHV
FT                   SATSTVERVQALVAAGRLPEKLANDLIDSLHFFMGLKLKVGLQQLETGHAASDEIALDK
FT                   LSSLDRDLLKDTLGVVKQFKALLNQRFHLEAM"
     atgcccagcg cattcaattt ttcggcgtcg ccgtttgact gcctcacgcc cgatgagcag        60
     cagctggtgc aggacagcgt cgatatcgcc tatttccccc agggcgccac cattttggcg       120
     ccgggtgcgc agccgacgca cctgtttgtc atcatcaagg gcttcgtcca gcagttcgac       180
     ggcaacgacg tggtcaccac ctatggccct gaagactgct tcgatggccg ggggctgatg       240
     gccggcaagg tcagcagccg cttcgtggcg gccgaggagg tcgtggccta ccagctggcc       300
     aggcaggcgg tcagcgacct gattgccggc aatgtgacct ttggcgcgct gctgttctcg       360
     gacttgtcca acaagctcag cgccctgtcc gagcggcaaa gccggcacga attgcagtcg       420
     ctgacgatgg cgcgggtcga tgaggctttt gtgcgcacgc cgcattttgt cgatgccgac       480
     atgtcgattc tggacgtgac ccggcagttt cattcgctgc gcacggcgac cctgctggtg       540
     cgtgactcgc aggtctcgcc gccggccctg gggattttta ccctgaccgg gctgcagcgg       600
     gcaattctgg acggcacgcc gctggaccgc ctggccgtca gggggctgac caatttttca       660
     ctgatcaagg tgcggcccag cgaccagctg ggcgatgccc tggcggtcat gatcaagcac       720
     aaggtgcatc gggtggtggt ggccgaaggc gagcacatca ccggcgtgct cgaagcgctg       780
     gacctgttca gctttttgtc caaccactcc tacctcatca acgtccagat acttgatgcc       840
     cgggatgtgc cggcccttca agaggcggcc gggcagatca cccggctgat ttcgctgctg       900
     cagcgcagcg gcacccatat caacatgatt gcccgcctgg tgcaggaact caatgccaag       960
     ctgttcgagc gcgcctggca gctgattgcg ccgcctgacc ttgttgccaa cagttgcctg      1020
     ttcgtgatgg gcagcgaagg ccggggcgag caactgctca agaccgacca ggacaacggc      1080
     ctggtgctgc gcgacggcta cgagccggct tgcgatgtgg ctgcggtgtg ccggcggttt      1140
     tcagcggcgc tggctgattt tggctacccg ccgtgcccgg gcaacatcat ggtcagcaac      1200
     ccgcagtggt gccagagcgt gaccgatttc agccagacgg cccgcctgtg gctgatggcg      1260
     gccaccaccg acggactgat ggcgctggcc atcttccttg atgcccatgc ggtgtgcggc      1320
     gaccgcacgc tgttggacaa ggtgcgggcg gcggtgtatg acatgaccgc cgacaacgat      1380
     gccatgctgg cgcgcttcgc ctcggccatc aacgccttcg gcaacagcag cgcctggtgg      1440
     aaccgcctgc tgttccgggg cgaccagggc aaggaagcgc tggacatcaa gaaagccggc      1500
     acctttccgc tggtgcatgg cgtgcgcagc ctggcgctgg cccatcatgt cagtgccacc      1560
     tcgaccgtgg agcgcgtcca ggcgctggtg gccgccggcc ggttgcctga aaagctggcc      1620
     aatgacctga tcgacagcct gcatttcttc atggggctca agctcaaggt cggcttgcag      1680
     cagttagaga ccggccatgc ggcatcggac gagatcgcgc tggacaagct cagcagcctg      1740
     gaccgcgact tgctgaaaga cacgctgggc gtcgtcaagc agttcaaggc cttgctgaac      1800
     cagcgctttc acctggaggc gatgtga                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page