(data stored in ACNUC7421 zone)

EMBL: CP000529.PE476

CP000529.PE476       Location/Qualifiers
FT   CDS_pept        502623..503285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0481"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: wsu:WS0596 DNA polymerase III,
FT                   epsilon subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35803"
FT                   /db_xref="GOA:A1VJH5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH5"
FT                   /protein_id="ABM35803.1"
FT                   /translation="MSVFAGLPPSRWFAALKREWLLYHLGDPRFRFMWDPAPENEWVAL
FT                   DCETTGLNTRTDDIIAIGAVRIRDNRIMTSERLELLVRPEKRRLSAESVRVHRLREQDV
FT                   AQGISADEAMMKLMYFIGSRPLVGYYLEFDLAMINRVLFPMLGMGLPQPKIEVSSMYYD
FT                   YKFHQLPHHARDSGSIDLRFESLMKDLNLPLWSAHDALNDAIMAALAFLKLRQLRAG"
     gtgagtgtct ttgccggcct gccgccgagc cgctggttcg cggcgctcaa gcgcgaatgg        60
     ctgctctacc acctgggcga cccgcgcttt cgcttcatgt gggacccggc gcccgagaac       120
     gaatgggtgg cgctggactg cgaaaccacc gggctgaaca cccggaccga cgacatcatc       180
     gccattggcg cggtgcgcat ccgggacaac cgcatcatga ccagcgagcg cctggagttg       240
     ctggtgcggc ccgagaagcg gcgcttgagc gccgaaagcg tgcgcgtgca tcgcctgcgc       300
     gagcaggatg tggcgcaagg catcagcgcc gacgaggcga tgatgaagct gatgtatttc       360
     atcggcagcc ggccgctggt gggctactac ctggagtttg acctggccat gatcaaccgg       420
     gtgctgttcc cgatgctcgg catgggcctg ccccagccca agatcgaagt gtcgtcgatg       480
     tactacgact acaagttcca ccagttgccg caccatgcgc gcgacagcgg ctcgattgac       540
     ctgcgctttg aaagcctcat gaaagacctg aacctgccgc tctggtcggc ccacgacgcg       600
     ctgaacgacg ccatcatggc ggcgctggct tttttgaagc tgcggcagtt gcgggcgggg       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page