(data stored in ACNUC7421 zone)

EMBL: CP000529.PE477

CP000529.PE477       Location/Qualifiers
FT   CDS_pept        503441..503794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0482"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35804"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH6"
FT                   /protein_id="ABM35804.1"
FT                   /translation="MKGFAMRYLNIKFSPLSAALVLSAACLLGCSVLQAGEQAASAPGD
FT                   PALAAAVTQAIHDALDYKAKDIQVAVNGGVVMLSGWANQPSDESRARAVASRVPGVMRA
FT                   YSRVHLWSSDDSY"
     gtgaaaggat ttgctatgag gtacctgaac atcaagtttt cacctctgtc cgcagccctc        60
     gttttgtcgg ctgcctgctt gctcggctgt tccgtcctgc aggcgggtga acaagccgcc       120
     tccgcgccgg gagaccccgc actcgccgct gccgtgacgc aggccatcca tgacgccctg       180
     gactacaaag ccaaggatat tcaggtggca gtcaatggcg gtgtcgtcat gctcagcggt       240
     tgggccaacc agcccagcga tgagtcgcgc gcacgcgcgg tggccagccg ggtgcctggc       300
     gttatgcgtg cctacagccg agttcacctg tggtccagcg acgactctta ttga             354
//

If you have problems or comments...

PBIL Back to PBIL home page