(data stored in ACNUC7421 zone)

EMBL: CP000529.PE478

CP000529.PE478       Location/Qualifiers
FT   CDS_pept        complement(505881..506234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0484"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   xoo:XOO4547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35805"
FT                   /db_xref="GOA:A1VJH7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH7"
FT                   /protein_id="ABM35805.1"
FT                   /translation="MTNYPSRRKFMSDPVRVDPMVAKVEANPKYHELRRKRNTFGWSMT
FT                   ALMMVVYYGYIALIAFNKPFLAQPIGAGVTSLGVPIGFGVIVFTIVITGIYVRRANGEY
FT                   DRLTAEILKEASK"
     atgacgaact acccaagtcg gaggaaattt atgagtgatc ctgtcagggt tgaccccatg        60
     gtggccaagg ttgaggccaa ccccaaatac cacgagcttc gtagaaagcg caacaccttt       120
     ggctggtcca tgaccgcgct catgatggtg gtgtactacg gctacatcgc gctgattgcg       180
     ttcaacaagc cttttctggc gcaaccgatt ggcgctggcg tcacatcgct gggcgttccc       240
     atcggctttg gcgtgattgt tttcaccatc gtcatcaccg gcatctatgt tcgccgcgcc       300
     aacggcgaat acgaccgcct gaccgccgaa atcctgaaag aggcttccaa atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page