(data stored in ACNUC7421 zone)

EMBL: CP000529.PE479

CP000529.PE479       Location/Qualifiers
FT   CDS_pept        506556..508214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0485"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pol:Bpro_4142 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35806"
FT                   /db_xref="GOA:A1VJH8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH8"
FT                   /protein_id="ABM35806.1"
FT                   /translation="MATTVDKSVMTAEQRKVIFASSLGTVFEWYDFYLYGSLAAIIAKQ
FT                   FFSGLDAGSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTIVIMGLSTFIV
FT                   GLLPSYASIGVAAPVILIALRMLQGLALGGEYGGAAVYVAEHAPEGRRGAYTSWIQTTA
FT                   TMGLFLSLLVILGVRTAVGEVAFADWGWRVPFVVSILLLAVSVYIRLSMNESPAFQKMK
FT                   AEGRTSKAPLSESFGQWKNLKIVILALVGLTAGQAVVWYSGQFYSLFFLTQALKVDGPT
FT                   ANILVAYSLLLATPFFVVFGTLSDKIGRKPIIMAGCLLAALTYFPVFTALTKAANPDLA
FT                   EAQARNQVVVTADPKECSFQFNPTGTAKFTSSCDIAKQVLAGASVSYENVAGPAGTVAS
FT                   IKIGQNAIPSYTAKGLSADEARKKDVEFKKLIGDDLKAAGYPSKADPAKMDKVMVTAIL
FT                   FYLVLLVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTTAFAIVAQTGN
FT                   MYNGLWYPIIIAGVTFVVGTLFVKETKDYDIYAND"
     atggcaacaa cagtcgataa gagtgtcatg acggcagagc agagaaaggt gatttttgcc        60
     tcctccctgg gcacggtatt cgagtggtac gacttttatc tgtatggctc tctggcggcg       120
     attattgcca agcagttttt cagtgggctg gacgctggtt cggcattcat tttcgccctg       180
     ctggcgtttg ccgccgggtt catcgtgcgt ccgtttggtg cgctggtctt tggccgcctg       240
     ggcgacatga ttggccgcaa gtacaccttt ctggtcacca tcgtgatcat gggcctgtcc       300
     actttcatcg tcgggctgct gcccagctac gcatcgattg gcgtcgcggc gccagtgatc       360
     ctgattgcgc tgcgcatgct gcagggcctg gccctcggcg gtgaatatgg cggcgctgcg       420
     gtttatgtgg ccgagcatgc gcccgaaggc cggcgcggtg cctacacctc ctggatccag       480
     accacggcga cgatgggcct ttttctgagc ctgctggtga ttctgggggt gcgcaccgcc       540
     gtgggcgaag tcgcgtttgc cgactggggc tggcgcgtgc ccttcgtggt ttccatcttg       600
     ctgctggccg tgtcggtgta catccggctg tcgatgaacg agtcgcctgc cttccagaaa       660
     atgaaggccg aaggccggac gtcgaaggcg ccgctgtccg agtctttcgg ccagtggaaa       720
     aacctgaaga tcgtgatcct ggcgctggtc ggcctgaccg ccggccaggc cgtcgtctgg       780
     tattcgggcc agttctattc cctgttcttc ctgacccagg cgctcaaggt cgatggcccg       840
     accgccaaca tcctggtggc ttactcgctg ctgctggcga cgccgttttt cgtggtgttc       900
     ggcaccctgt ccgacaagat aggccgcaag cccatcatca tggcgggctg cctgctggcc       960
     gccctgactt attttccggt gttcaccgcg ctgaccaagg cggccaatcc tgacctggcc      1020
     gaggcgcagg ccaggaacca ggtggtggtg actgccgatc ccaaggaatg ctcgttccag      1080
     ttcaatccga ccggcacggc caagttcacc agttcctgcg acatcgccaa gcaggtgctg      1140
     gccggcgcat cggtcagcta cgaaaacgtg gccgggcccg ccggcacggt cgcctcgatc      1200
     aagattggcc agaacgccat ccccagctac acggccaagg gcctgagcgc tgacgaggcc      1260
     cgcaaaaagg atgtggagtt caagaagctc attggcgatg acctgaaggc agccggctac      1320
     ccctcaaagg ctgatccggc caagatggac aaggtcatgg tcacggcgat cctgttttac      1380
     ctggtgctgc tggtcaccat ggtctatggc ccgattgccg ccatgctggt cgagatgttc      1440
     cccacgcgca tccgctacac ctcgatgagc ctgccgtatc acatcggcaa cggctggttt      1500
     ggcggcctgc tgcccaccac cgcttttgcc atcgtggcgc aaaccggcaa tatgtacaac      1560
     gggctgtggt atccgatcat cattgccggt gtgaccttcg tggtgggaac cttgttcgtc      1620
     aaggaaacta aggattacga catctacgcc aacgattga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page