(data stored in ACNUC7421 zone)

EMBL: CP000529.PE482

CP000529.PE482       Location/Qualifiers
FT   CDS_pept        510042..515939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0488"
FT                   /product="UvrA family protein"
FT                   /note="KEGG: pol:Bpro_4139 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35809"
FT                   /db_xref="GOA:A1VJI1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI1"
FT                   /protein_id="ABM35809.1"
FT                   /translation="MSQGTIRIRGACQHNLKNIDLDIRTGELTVVTGPSGSGKSSLVFD
FT                   TLFAEGQRRYVETFSAYARQFLDRMDKPAVDKVEGVPPAIAIDQTNPVRSSRSTVGTMT
FT                   ELNDHLKLLYARAAQLFDRQTALAVRHDSPESIYAELMARTAGADPRVVMTFPVELPGN
FT                   TSAAEVEQWLSASGFTRVHAQRDVATPAGPHKLLDVVADRFRLHLTEKIRVIEAIETAL
FT                   KRGGRLNVYVQPGQPGEAEEMWRFSTGLHCPESDLRYTDPTPSLFSFNSAMGACETCKG
FT                   FGRVIGVDYGLVIPNDRLTLRAGAIKVMQTPAWKEAQDDLMRHAEAEGIPRDTPWYKLT
FT                   PEQQAWVINGSPDWKGKWEKHWFGIKRFFAYLESKAYKMHIRVLLSKYRSYTTCEACGG
FT                   ARLKLESLQWRLGSKEAADAVLPPAERFMPVGVQWTRAQLEAMPGLCLHDLMRLPIDRL
FT                   QKFSGSLSFAAAGDDAEQKALKSLFEEIRTRVKYLCDVGIGYLTLDRQSRTLSGGEVQR
FT                   INLTTALGTSLVNTLFVLDEPSIGLHPRDMHRITQAMRRLVDAGNTLVVVEHDPAVMLA
FT                   ADRMIDMGPGPGEKGGQIVFDGTPEEVRHADTLTGAYLGGRKLVGMGLKRAVTDNTPRL
FT                   VLEGARDHNLKNLTVEFPLQRLVCVTGVSGSGKSTLMQDILAPALLRQFGKATETPGLH
FT                   DRLLGAERLTDVVFVDQSPIGKTARSNPASYVGAWDAVRELFALSPLARQRSYTASKFS
FT                   FNNGDGRCPTCGGSGFEHVEMQFLSDVYLRCPDCDGKRYRPEILEVTIERQAIGQLKSR
FT                   LLNVADVLDLTVSEAVQLFAQDREVMRALQPILDVGLEYVKLGQPVPTLSGGEAQRLKL
FT                   AGFLAGASKAAGQRQSASGQALALKHPNRGTLFLFDEPTTGLHFDDIAKLMRALRRLLE
FT                   AGHSLIIIEHNLDVIRSADWLIDLGPEGGENGGLLVAEGPPEIVRHHPTSHTALALRDY
FT                   EQAMSKSYKVEEPRPKAWKTRPAFSNLIQIVNARENNLKSLSVDIPRGKFNVVTGVSGS
FT                   GKSTLAFDILFNEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQRLSRGGR
FT                   KSTVGTTTEVWHFLRLLYVKLGIQHCTKDGAAVMPQSPESIAAQLLKTYRGQHIGLLAP
FT                   LVMNRKGVYTELADWARPRGYTHLRVDGEFLPTTGFPRIDRFKEHTVELPIADIHVTPD
FT                   NEAALRQALATALEHGKGVVHVLATLDGLWEAMLAGASTQAIGRIEAFSTRRACPVCST
FT                   SYPELDPRLFSYNSKHGWCPDCVGTGVKLTRDQRKVFDDSVLGSDDNKGREQTFGEPET
FT                   DDVLDAVCPACAGTRLNPQARAVLFADAGIADIAALSVTDVRGWVDQLALSGREAGIAR
FT                   DLVPEIRSRLEFLEDVGLGYLTLDRGAPTLSGGEAQRIRLAAQLGSNLQGVCYVLDEPT
FT                   IGLHPRDNQILLGALGKLSERGNTLVVVEHDEDTIRRADNIIDIGPGAGKRGGTLVAQG
FT                   TAAQLSAVPESLTGRYLANPLIHPLHARRQTLAGSAVAELDSDPGAAASPGAVPAKPLS
FT                   KARQAALKAQALKAAAAQASAQHNAAPAAASPFTSWLTVVNASLHNLKNVTVEVPLYRL
FT                   VAVTGVSGSGKSTLARDVLLTSVHAGVTQRSTKAGREADDAGKHPAWTGCERIEGYRVV
FT                   DRVLEVDQTPIGKTPRSCPATYIGFWDTVRKLFADTLEARARGYAAGRFSFNTGEGRCP
FT                   TCEGAGVRTIGMSFLPDVKVLCETCHGARFNPETLAVTWRGKSIGDVLKMEVDEAVDFF
FT                   AAMPAIGHPLQLLKDVGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDITRRGQKAP
FT                   HTLYVLDEPTVGLHMADVEKLIHVLHRLVNGGHSVIVIEHDLDVIAEADWVIDLGPDGG
FT                   NAGGLVVASAPPEAVVALGTATGKALAAVLAR"
     atgtcccagg gaaccatccg cattcgcggc gcgtgccagc acaacctcaa aaatatcgac        60
     ctggacatcc gcaccggcga gctgacggtg gttaccggtc ccagcggctc gggcaagtcc       120
     agcctggtgt tcgacacgct gtttgccgaa ggccagcgcc gctatgtcga aaccttctcg       180
     gcctatgcgc ggcagttcct ggaccgcatg gacaagccgg cggtggacaa ggtcgagggc       240
     gtgccgccgg cgattgccat cgaccagacc aatccggtgc gctcctcgcg ctcgaccgtc       300
     ggcaccatga ccgaactcaa cgaccacctg aagctgcttt acgcccgggc cgcgcagctg       360
     ttcgaccggc agacggcact ggccgttcgg cacgactctc cggaatccat ctacgccgag       420
     ctgatggcgc gcaccgcagg cgctgacccg cgcgtcgtca tgaccttccc ggtcgagctg       480
     ccgggcaaca ccagcgccgc agaggtcgag cagtggctgt cggccagcgg cttcacgcgc       540
     gtccatgcgc agcgcgacgt ggcaacgccc gccgggccgc acaagctgct cgacgtggtg       600
     gccgaccgct ttcgcctgca cctgactgaa aaaatccgcg tcatcgaggc gattgaaacc       660
     gccctgaagc gcggcggccg cctgaatgtg tatgtgcagc cgggccagcc tggcgaggcc       720
     gaagaaatgt ggcgcttttc caccggcctg cattgccctg aaagcgacct gcgctacacc       780
     gatcccacgc cgtcgctgtt ttccttcaat tcggccatgg gcgcctgcga gacctgcaag       840
     ggctttggcc gcgtgatcgg tgtcgattac gggctggtga ttccgaacga caggctcacg       900
     ctgcgcgccg gcgccatcaa ggtgatgcag acgccggcct ggaaggaagc gcaggacgat       960
     ttgatgcgcc acgccgaagc cgagggcatt ccgcgcgaca cgccctggta caagctcaca      1020
     cccgagcagc aggcctgggt gatcaacggc tcgcctgact ggaaggggaa atgggagaag      1080
     cactggttcg gcatcaagcg cttctttgct tacctggaga gcaaggccta caagatgcac      1140
     atccgggtgc tgctgtccaa gtaccgcagc tacaccacct gcgaggcctg cggcggcgcg      1200
     cggctcaagc tcgaatcgct gcagtggcgg ctgggcagca aggaggccgc cgatgcggtc      1260
     ttgccgccgg ccgagcgctt catgccggtc ggcgttcaat ggacgcgcgc acagctcgaa      1320
     gcgatgccgg ggctgtgcct gcatgacctg atgcgcttgc caattgaccg gttgcagaag      1380
     ttctccggca gcctttcatt tgccgctgct ggcgatgatg ccgagcaaaa ggccctgaaa      1440
     tcgctgttcg aggaaatccg cacgcgcgtc aaatacctct gcgatgtcgg catcggctac      1500
     ctgacgctgg accgccagag ccgcacgctg tcgggcggcg aggtgcagcg catcaacctg      1560
     acgaccgcgc tgggcacgtc gctggtcaac accctgttcg tgctcgacga gccgtccatc      1620
     ggcctgcatc cgcgcgacat gcaccgcatc acgcaggcga tgcgccggct ggtcgatgcc      1680
     ggcaacacgc tggttgtcgt cgagcacgac ccggccgtca tgctggccgc cgaccgcatg      1740
     atcgacatgg ggccggggcc gggcgagaag ggcgggcaga tcgtcttcga cggcacgccc      1800
     gaggaagtgc ggcatgccga cacgctgacc ggcgcctacc tgggcgggcg caagctggtc      1860
     ggcatgggct tgaagcgcgc cgtgaccgac aacacgccgc gcctggtttt agagggcgcg      1920
     cgcgaccaca acctgaaaaa cctcacggtc gagttcccgc tgcagcgcct ggtctgcgtg      1980
     accggcgtca gcggctcggg caaatcgacg ctgatgcagg acatcctggc gcccgcgctg      2040
     ctgcgccagt tcggcaaggc gaccgaaacg ccgggcctgc atgaccggct gctgggcgcc      2100
     gagcgcctga cggacgtggt gtttgtcgat cagtcgccga ttggcaagac cgcgcgctcg      2160
     aacccggcca gctatgtcgg cgcctgggac gccgtgcgcg agctgttcgc cctgtcgccg      2220
     ctggcccggc agcgcagcta cacggcgagc aaattcagct tcaacaatgg cgatggccgc      2280
     tgcccgacct gcggcggctc gggcttcgag catgtcgaga tgcagttcct gagcgacgtg      2340
     tacctgcgct gccccgactg cgacggcaag cgctaccggc ctgaaatcct cgaagtcacg      2400
     attgagcgcc aggccatcgg ccagctcaaa tcccggctgc tcaatgtggc cgatgtgctg      2460
     gatttgaccg tcagcgaagc cgtgcagctg ttcgcgcagg accgcgaagt catgcgcgcc      2520
     ctgcagccca tccttgatgt cgggctggaa tacgtcaagc tcggccagcc cgtgcccacg      2580
     ctctcgggcg gcgaggcgca gcggctcaag ctcgcgggct tcctggccgg cgccagcaag      2640
     gcggcgggcc agcgccagag cgccagcggg caggcgctgg cgctcaagca cccgaaccgg      2700
     ggcacgctgt ttctgttcga cgagccgacc accggcctgc atttcgacga catcgccaag      2760
     ctcatgcgcg cgctacgccg gctgctggag gccggccatt cgctgatcat catcgagcac      2820
     aacctggacg tgatccgctc ggccgactgg ctgatcgacc tcggccctga aggcggcgag      2880
     aacggcggcc tgctggtggc tgaagggccg ccggaaatcg ttcgccatca tcccacgtcg      2940
     cacacggcgc tggccttgcg cgactacgag caagccatga gcaagtcgta caaagttgaa      3000
     gagccaaggc ccaaggcctg gaagacgcgg ccggcttttt ccaacctgat tcagatcgtc      3060
     aacgccaggg aaaacaacct caaaagcctg tcggtcgata ttccgcgcgg caagttcaat      3120
     gtggtcacgg gtgtcagcgg ctcgggcaaa tcgacgctgg cctttgacat tttgttcaac      3180
     gagggccagc gccgctacct ggagtcgctc aacgcctacg cccgcagcat cgtgcagccg      3240
     gcgggccggc ccgaggtcga tgcggtttac ggcattccgc ccacggtggc catcgagcag      3300
     cggctgtcgc gcggcgggcg caaatcgacc gtcggcacga ccaccgaggt ctggcacttt      3360
     ttgcgcctgc tctacgtcaa gctgggcatc cagcactgca ccaaggatgg cgcggcggtc      3420
     atgccgcaaa gccccgagag catcgccgcc caattgctga agacctaccg gggccagcac      3480
     atcggcctgc tcgcgccgct ggtgatgaac cgcaagggcg tctatacgga actcgccgac      3540
     tgggcgcggc cgcgcggcta cacgcatctg cgcgtcgatg gcgagttttt gccgaccacc      3600
     ggctttccgc gcatcgaccg cttcaaggaa cacacggtcg agttgccgat tgccgacatc      3660
     cacgtcacgc ccgacaacga agccgcgctg cggcaggccc tggccaccgc gctggagcat      3720
     ggcaagggcg tggtgcatgt gctggcaacg cttgatggcc tgtgggaggc gatgctggcc      3780
     ggcgccagca cccaggcgat tggccggatc gaggccttct cgacgcgccg cgcctgcccg      3840
     gtctgctcca cgtcttatcc cgaactcgac ccgcgcctgt tcagctacaa cagcaagcac      3900
     ggctggtgcc cggactgcgt cggaaccggc gtcaagctga ccagggacca gcgcaaggtg      3960
     ttcgacgatt cggtgctggg cagcgacgac aacaagggcc gcgagcagac ctttggcgag      4020
     cccgagaccg acgacgtgct cgatgcggtt tgcccggcct gcgcaggcac gcgcctgaac      4080
     ccgcaggcgc gtgccgtgct gtttgccgat gccgggattg ccgacattgc cgcgctgtcg      4140
     gtgaccgatg tgcgcggctg ggtcgatcaa ctggcgctca gcggacgcga agccggcatc      4200
     gcccgcgacc tggttcctga gatcaggagc cgtcttgaat tcctcgaaga cgtgggcctg      4260
     ggctacctca cgctggaccg gggcgcgccg acgctgtcgg gcggcgaggc gcagcgcatc      4320
     cggctggccg cgcagctggg ctcgaacctg cagggcgtct gctatgtgct tgacgagccg      4380
     acgattggcc tgcatccgcg cgacaaccag attctgctcg gcgccctggg caagctcagc      4440
     gagcgtggca acacgctggt ggtggtcgag catgatgaag acacgattcg ccgcgccgac      4500
     aacatcatcg acatcggccc cggcgccggc aagcgcggcg ggacgctggt ggcgcagggc      4560
     acggcggcgc agctgtcagc cgtgccggaa tcgctcacgg gacgctatct ggcgaacccg      4620
     ctgattcatc ccttgcatgc gcgccgccaa acgcttgctg gaagcgctgt cgctgaattg      4680
     gactctgacc ccggtgcagc ggcctcaccg ggcgcagttc ccgccaaacc cctgagcaag      4740
     gccaggcagg ccgccctgaa agcccaggcc ctcaaagccg cagccgccca agccagcgcc      4800
     cagcacaacg cagcgcccgc cgccgccagc ccgttcacct cgtggctgac agtcgtcaac      4860
     gccagcctgc acaacctcaa aaacgtcacc gtcgaagtgc cgctctaccg gctggtcgcc      4920
     gtcaccggtg tttcgggctc cggcaaatcc acgctggcgc gcgacgtgct gctgaccagc      4980
     gtccacgccg gcgtcacgca gcgctcgacc aaggccgggc gcgaggccga cgacgccggc      5040
     aagcacccgg cctggaccgg ttgcgagcgc atcgaaggct atcgcgtcgt ggaccgcgtg      5100
     ctcgaagtgg accagacgcc catcggcaag accccgcgct cctgtccggc gacctacatc      5160
     ggcttctggg acacggtgcg caagctgttc gccgacacgc tcgaagcgcg cgcgcgcggc      5220
     tacgcggcag ggcgcttttc cttcaacacc ggcgaaggcc gctgcccgac ctgcgaaggc      5280
     gcgggcgtgc gcaccatcgg catgagcttt ctgcccgatg tgaaggtgct gtgcgaaacc      5340
     tgccacggcg cgcgcttcaa ccccgaaacg ctggctgtca cctggcgcgg caaaagcatc      5400
     ggcgacgtgc tgaagatgga agtcgatgag gcggtggatt tcttcgccgc catgcccgcc      5460
     atcggccacc cgctgcaact gctcaaggat gtgggcctgg gctacctcac gctgggccag      5520
     ccgtcgccca cgctgtcggg cggcgaggcg cagcgcatca agctggtgac cgaactcagc      5580
     aaggtgcgcg acgacatcac ccggcgcggc cagaaggcgc cgcacacgct gtatgtgctc      5640
     gacgagccga ccgtcggcct gcacatggct gatgtcgaaa agctgatcca tgtgctgcac      5700
     cgcctggtca acggcggcca tagcgtgatc gtcatcgagc acgacctcga cgtgattgcc      5760
     gaagccgact gggtgatcga cctggggccg gacggcggca acgcgggcgg gctggtggtg      5820
     gcctccgcgc cgcccgaagc cgtggtggcg ctgggcacag cgaccggcaa ggcgctggcg      5880
     gcggtgctgg cgcgctag                                                    5898
//

If you have problems or comments...

PBIL Back to PBIL home page