(data stored in ACNUC7421 zone)

EMBL: CP000529.PE483

CP000529.PE483       Location/Qualifiers
FT   CDS_pept        516348..517784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0489"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: pol:Bpro_4132 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35810"
FT                   /db_xref="GOA:A1VJI2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI2"
FT                   /protein_id="ABM35810.1"
FT                   /translation="MNIALKTMLNTDHIIADLTLAAWGRKELKIAETEMPGLMAIRQEF
FT                   AAAQPLKGARITGSLHMTIQTGVLIETLQALGAEVRWASCNIFSTQDHAAAAIAAEGTP
FT                   VFAVKGETLADYWDYTHRIFEFTGAKGTPEEGPNMILDDGGDATLLMHLGARAETDASL
FT                   LEYPASEEETCLFGAIKAKLAQDPTWYSRRLANIIGVTEETTTGVLRLNEMSAKGTLAF
FT                   RAINVNDSVTKSKFDNLYGCRESLVDAIKRATDVMIAGKVAVVAGYGDVGKGCAQALRA
FT                   LSAQVWVTEIDPINALQAAMEGYKVVTMDYAADKCDIFVSATGNKNVITYAHMAAMKDQ
FT                   AIVCNIGHFDNEIDVASLESCNWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCGTGHP
FT                   SFVMSSSFANQTIAQIELFTKQAEYEAGKVYVLPKHLDEKVARLHLKKVGAMLSELSDE
FT                   QAAYIGVSKAGPYKANTYRY"
     atgaacattg cactaaaaac catgttgaat accgaccaca tcattgccga cctgacgctg        60
     gccgcctggg gtcgcaagga actcaaaatc gccgagaccg aaatgcccgg cctgatggcg       120
     attcgccagg aattcgccgc tgcccagccg ctcaagggcg cgcgcatcac cggctcgctg       180
     cacatgacca tccagaccgg cgtgctgatt gaaaccctgc aggcgctggg cgccgaagtg       240
     cgctgggcct cgtgcaacat cttctcgacg caggaccatg ccgccgccgc gattgccgct       300
     gaaggcacgc cggtgttcgc cgtcaagggc gaaaccctgg ccgactactg ggactacacc       360
     caccgcatct tcgaattcac cggcgccaaa ggcacgcccg aagaaggccc gaacatgatc       420
     ctggacgacg gcggcgatgc cacgctgttg atgcacctgg gcgcccgcgc cgaaaccgat       480
     gcgagcctgc tcgaataccc cgccagcgag gaagaaacct gcctgttcgg cgccatcaag       540
     gccaagctgg cgcaagaccc gacctggtac agccgccgcc tggccaacat catcggcgtg       600
     accgaggaaa ccaccaccgg cgtgctgcgc ctgaacgaaa tgtcggccaa gggcacgctg       660
     gcgtttcgcg ccatcaacgt caacgactcg gtcaccaagt ccaagttcga caacctctac       720
     ggctgccgcg aatcgctggt cgatgccatc aagcgcgcca ccgatgtgat gattgccggc       780
     aaggtcgccg tggtggctgg ctacggcgat gtgggcaagg gctgcgccca ggccctgcgc       840
     gcgctcagcg cccaggtctg ggtcaccgaa atcgacccga tcaacgccct gcaggccgcg       900
     atggaaggct acaaggtcgt gaccatggac tacgccgccg acaagtgcga catcttcgtc       960
     tcggccaccg gcaacaagaa cgtcatcacc tatgcgcaca tggcggccat gaaagaccag      1020
     gccatcgtct gcaacatcgg ccacttcgac aacgagatcg acgtggcgtc gctggaaagc      1080
     tgcaactggg aagagatcaa gccgcaggtg gatcatgtga tctttcccga cggcaagcgc      1140
     atcatcttgc tggccaaggg gcgtctcgtg aacctgggct gcggcaccgg ccacccgagc      1200
     ttcgtcatgt cgtcgagctt tgcgaaccag acgattgcgc agatcgagct gttcaccaag      1260
     caggccgaat acgaagccgg caaggtctat gtgctgccca agcacctcga tgaaaaggtg      1320
     gcccgcctgc acctgaagaa ggtcggcgcg atgctgtccg aactgagcga cgagcaggca      1380
     gcgtatattg gcgtgtccaa agccggccct tacaaggcca atacctaccg ttattga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page