(data stored in ACNUC7421 zone)

EMBL: CP000529.PE490

CP000529.PE490       Location/Qualifiers
FT   CDS_pept        complement(523803..524825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0496"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   pol:Bpro_4114 protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35817"
FT                   /db_xref="GOA:A1VJI9"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI9"
FT                   /protein_id="ABM35817.1"
FT                   /translation="MFSYRHAFHAGNHADVLKHTCLIALMKYLTQKDTALTVIDTHAGA
FT                   GLYRLDGDYTETSGEAQEGIFKLLLASKMASAQTGKAGAAIKKVAPAATAKAAPAAPEP
FT                   AAKPASDYAWAPALLDYLELLRSLNPHFAQTGDPAHLKIYPGSPFIEQKFLSGRDKLKL
FT                   FELHPTDFKSLSGNIEQLGVGRQVVVAREDGFEALKTFLPPPARRAMVLCDPSYEMKTD
FT                   YLRVSSCMADAVKRFATGTYVVWYPIIPRPEAHDLPRKLKTIAVKAGRSWLNATLTVKS
FT                   SKLTTDTEGEVVRPGLPASGMFVINPPHTLKAELQAALPQMVALLGQDRNAGFTLEHGG
FT                   "
     atgttttctt atcgccacgc cttccatgca ggcaaccatg ccgacgttct caagcacacc        60
     tgcctgattg cgttgatgaa gtacctgacc caaaaagaca cggccctgac cgtgatcgac       120
     acccacgccg gcgccggcct gtaccgcctc gacggcgact acaccgagac cagcggcgaa       180
     gcgcaggaag gcatcttcaa gctgcttttg gcatcaaaaa tggcttctgc gcagactggt       240
     aaagccggag cagctattaa aaaagtagcg cctgcagcca cggccaaagc cgctcccgca       300
     gcacctgagc cagccgccaa gcccgccagc gactacgcct gggcgccggc cctgctggac       360
     tacctggaac tgctgcgcag cctgaacccg catttcgccc agaccggcga cccggcgcat       420
     ctgaagattt accccggctc gcccttcatc gagcagaaat tcctgagcgg gcgcgacaag       480
     ctcaagctgt tcgagctgca cccgaccgat ttcaagtcgc tttccggcaa catcgagcag       540
     ctcggcgtgg gccgccaggt cgtggtggcc cgcgaggacg gcttcgaggc gctgaaaacc       600
     ttcttgccgc caccggcccg gcgcgccatg gtgctgtgcg acccgagcta tgaaatgaag       660
     accgactacc tgcgcgtctc aagctgcatg gccgacgccg tcaagcgctt tgccaccggc       720
     acctacgtgg tctggtatcc gatcattccg cgccctgaag cgcacgacct gccgcgcaag       780
     ctcaagacca tcgcagtcaa ggccggccgc agctggctga atgccacgct gacggtcaag       840
     tcgagcaagc tgaccaccga caccgaaggc gaagtcgttc gccccggcct gcccgccagc       900
     ggcatgttcg tcatcaaccc gccgcatacg ctgaaagccg aactgcaggc cgcgctgccg       960
     caaatggtcg cgctgctcgg ccaggaccgc aacgccggct tcacgctgga acacggcggc      1020
     taa                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page