(data stored in ACNUC7421 zone)

EMBL: CP000529.PE492

CP000529.PE492       Location/Qualifiers
FT   CDS_pept        526614..527906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0498"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   pol:Bpro_1473 protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35819"
FT                   /db_xref="GOA:A1VJJ1"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ1"
FT                   /protein_id="ABM35819.1"
FT                   /translation="MQCLSRRAPTTAPGKPTRKQKMNYEMHQVEGGVPVKMWTQGVPVE
FT                   AVALRQLENTARLPIVFSHVAAMPDVHYGIGATVGSVVATFKAIIPASVGVDIGCGMIA
FT                   CKTTLRAEDLPDSLAQLRSEIEKAVPHGMTPKEQRRGGSRDRGSWENPPNEADAAWAQL
FT                   VDEFEAICLDYPRLKNTNNHRHMGTLGGGNHFIEVCLDEAGAVWIMLHSGSRGVGNAIG
FT                   THFIELARKDAELHQRNLPDKDLAYFEEGAQYFGDYVRGVGWAQKFAKLNREVMMQRTI
FT                   AALRKVVKKPFETHIEAVNCHHNYVARETHFGQDVFVTRKGAVSARAGELGIIPGSMGA
FT                   RSFIVRGKGNPESFMSCSHGAGRSMSRTRAKKLFTLADQIKATEGVECRKDEAVIDEIP
FT                   MAYKDIDAVMAAQTDLVEVVYILKQIVCVKG"
     atgcaatgtc tatcacgtcg ggcgccaaca acggcgcccg gcaagccaac aagaaagcaa        60
     aaaatgaatt acgaaatgca tcaggtcgaa ggcggcgtgc ccgtcaaaat gtggacgcag       120
     ggggttcccg tcgaggcggt ggcgctcagg cagctcgaaa acacggcccg gctgccgatt       180
     gtcttcagcc atgtcgcggc catgcccgat gtgcattacg gcatcggcgc aacggtgggc       240
     agcgtggtcg ccaccttcaa ggccatcatt ccggcgtcgg tcggcgtcga tatcggctgc       300
     gggatgatcg cctgcaagac cacgctgcgc gccgaagacc tgcccgacag cctggcgcag       360
     ctgcgcagcg agatcgaaaa agccgttccc cacggcatga cgcccaagga gcagcgccgt       420
     ggcggcagcc gtgaccgggg ttcctgggaa aacccgccga acgaggccga cgccgcctgg       480
     gcgcagctgg tggacgagtt cgaggcgatt tgcctggact acccgcgcct gaaaaacacc       540
     aacaaccacc gccacatggg aacgctgggc ggcggcaacc acttcatcga ggtctgcctg       600
     gatgaggccg gagcggtctg gatcatgctg cactcgggct cgcgtggggt tggcaatgcc       660
     atcggcacgc acttcatcga gctggccagg aaggacgcgg aactgcacca gcgcaacctg       720
     cccgacaagg atctggccta ttttgaagaa ggtgcgcagt atttcggcga ctatgtgcgc       780
     ggcgtgggct gggcgcagaa attcgccaag ctcaaccgcg aagtgatgat gcagcgcacg       840
     attgccgcgc tgcgcaaagt cgtcaagaag ccgttcgaga cgcacatcga ggcggtgaac       900
     tgccaccaca actatgtcgc cagggaaacc cattttgggc aggacgtgtt cgtgacccgc       960
     aaaggagccg tgagcgccag ggcgggcgaa ctgggcatca ttccgggcag catgggggcg      1020
     cgcagcttca ttgtgcgcgg caaggggaat cccgagagct tcatgagctg cagccatggt      1080
     gccggacgct cgatgagccg gacccgggcc aaaaagctgt tcacgctggc cgaccagatc      1140
     aaggccactg aaggcgtgga atgccgcaag gacgaggcgg tgattgacga aattccgatg      1200
     gcctacaagg acatcgacgc ggtcatggcc gcgcagaccg atctggtgga ggtggtgtac      1260
     atcctcaagc agatcgtctg cgtcaagggc tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page