(data stored in ACNUC7421 zone)

EMBL: CP000529.PE498

CP000529.PE498       Location/Qualifiers
FT   CDS_pept        complement(533105..534244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0504"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   pol:Bpro_4108 protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35825"
FT                   /db_xref="GOA:A1VJJ7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ7"
FT                   /protein_id="ABM35825.1"
FT                   /translation="MHDYTIGLMSGTSLDGADGVLVDFSSQTLRVVASASEPFGDSFRA
FT                   ELLALNSPSHNELHRAALAGSQLAAVYAQVVAKLVRQAGAQGISASQIQAIGAHGQTVR
FT                   HQPQRTSAEPAGAGYTLQLNNPALLAELTGIDVVADFRSRDVAAGGQGAPLVPAFHQGV
FT                   FGRADATVAVLNLGGISNLSVLPPAGSPLPVLGFDCGPGNALMDAWCLRHTGQPFDAGG
FT                   TWAKSGRLVPALLASLRGEPYFSQPIPKSTGRDLFSLAWLDEKLRPFSGERPEDIQNTL
FT                   TELTVFACTAGVSSYGKESTELIVCGGGAFNLYLLQRLQAGLPWLRVSTSDQHGLPPLQ
FT                   VEAAAFAWLARQMIQRQPGNLPGVTGAAGLRVLGALYPA"
     atgcacgact acaccattgg cctgatgtca ggcacttccc ttgacggcgc cgacggcgtt        60
     ctggtcgatt tctcaagcca gacgctgcgc gtcgtcgcca gcgccagcga gccgtttggc       120
     gacagtttta gggctgaact gctggcgctc aattcgcctt cgcacaatga attgcaccgc       180
     gccgcgctgg cgggcagcca gctggcggcg gtctatgccc aggtggttgc caagctggtg       240
     cggcaagctg gcgcgcaggg catcagcgcc agccagatcc aggccattgg cgcgcacggg       300
     cagacggtca ggcaccagcc ccagcgaact tcagcagaac ctgcgggcgc gggctacacg       360
     ctccagctca acaatccggc cctgctggcc gaattgaccg gcattgacgt ggtggccgat       420
     ttccgcagcc gcgatgtcgc cgcaggcggc cagggtgcgc cgctggtgcc ggcgtttcac       480
     cagggtgtct ttggccgcgc ggacgccacg gtcgcggtgc tgaacctggg cggcatctcc       540
     aatctcagcg tgctgccgcc tgccggctcg cccttgccgg tgctgggctt tgactgcggg       600
     ccgggcaacg cgctgatgga cgcatggtgc ctgcggcaca ccggccagcc ttttgatgcg       660
     ggcggcacct gggcgaaaag cggccgactg gttccggcgc tgctggccag cctgcggggc       720
     gaaccctact tctcgcagcc gattcccaag agcacgggac gcgacctttt cagcctggcg       780
     tggctggatg aaaaactgcg ccccttttcc ggcgaacgcc ccgaggatat tcaaaataca       840
     ttgaccgaat tgacggtttt cgcatgtaca gcgggcgtta gcagctatgg aaaagagagc       900
     actgaactga tcgtctgcgg cggcggcgct ttcaatctgt atctgctgca gcgcctgcag       960
     gcgggcctgc cctggctgcg cgtcagcact tcggaccagc acggcctgcc gccgctgcag      1020
     gtcgaggcgg ctgcctttgc ctggctggcg cgccagatga tccaacgcca gcccggtaac      1080
     ctgcccggcg tgaccggcgc ggcgggcttg cgtgtgctgg gtgcgctgta tcccgcctga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page