(data stored in ACNUC7421 zone)

EMBL: CP000529.PE5

CP000529.PE5         Location/Qualifiers
FT   CDS_pept        5834..6508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35332"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI54"
FT                   /protein_id="ABM35332.1"
FT                   /translation="MHGFNHSRTLSIPTSSLPSPWKQQRFLRAIPSLMVLTTAIAWGTA
FT                   SHAGGLALDGALRNGVNVAAGPALDAGVSAGVGVDASAGVKGAGGMAGVDAAGSAGSGA
FT                   NRNITDEQRMAAMAAVGGDANAQGAAGVEAPGVGRTAGGVRGMGESVGGAAARTGQRAT
FT                   QGVRSEVSGGLKGGANAATNAASGARTGMPGIGKAGAAGARLGAGVDADAGAGLKGVIP
FT                   AR"
     atgcacggtt tcaaccattc ccgcacccta tcgatcccaa cctcttccct cccttccccg        60
     tggaagcagc agcgcttcct gcgggccatt ccttccctga tggtgctgac cacggccatc       120
     gcctggggca ctgcatcgca tgccggcgga ctggcccttg acggcgccct gcgcaatggc       180
     gtgaatgttg ccgcaggccc cgctctggat gctggcgtga gtgccggcgt gggcgtggac       240
     gccagtgccg gcgtgaaggg cgctggcggc atggccggag tcgatgccgc aggcagcgcc       300
     ggttctggcg ccaaccgcaa tatcacggat gagcagcgca tggcggccat ggctgcggtg       360
     ggtggcgatg cgaatgcgca gggcgccgct ggcgttgagg ctccaggcgt gggccgcacg       420
     gcaggcggcg tgcgtggcat gggcgaatcc gtcggcggcg ctgcggcgcg gaccggccag       480
     cgcgcgaccc agggcgtcag gtccgaggtt tcgggtggct tgaagggcgg cgcgaatgcc       540
     gccaccaacg ctgccagcgg cgccaggacc ggcatgccgg gcattggcaa ggccggtgcc       600
     gcaggcgcca ggctcggcgc tggcgtggat gccgatgcgg gggccggcct caagggcgtg       660
     ataccggcgc gttaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page