(data stored in ACNUC7421 zone)

EMBL: CP000529.PE50

CP000529.PE50        Location/Qualifiers
FT   CDS_pept        52061..52315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0051"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: rfr:Rfer_2848
FT                   thiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35377"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI99"
FT                   /protein_id="ABM35377.1"
FT                   /translation="MKITFKLFATLTDYLPLAARRGNLIELDVAPQATINQVIEPFGLP
FT                   PKLVHLVLVNGRYIEPEKRLTTTLLEGDVLAIWPPIAGG"
     atgaagatca ccttcaagct gttcgccacg ctgaccgact atttgccact ggcggcgcgg        60
     cgcggcaacc tcatcgaact ggacgtggcg ccccaggcca ccatcaacca ggtcatcgag       120
     cccttcggcc tgccgcccaa gcttgtccac ctggtgctgg tcaacggccg ctacatcgag       180
     cccgaaaagc gcctgaccac cacgctgcta gagggcgacg tgctggccat ctggccgccg       240
     attgccggcg gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page