(data stored in ACNUC7421 zone)

EMBL: CP000529.PE500

CP000529.PE500       Location/Qualifiers
FT   CDS_pept        535905..537137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0506"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein; KEGG: pol:Bpro_4106 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35827"
FT                   /db_xref="GOA:A1VJJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ9"
FT                   /protein_id="ABM35827.1"
FT                   /translation="MNQELVTNSPLSDRVKTALAVSLRGCDELIPQDEWTRKLVRSEAT
FT                   GVPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNSTR
FT                   PPLTPEQIKVNAETYYRQASLVLDPAKTEIRYNSEWCDPLGARGMIQLASRYTVARMME
FT                   RNDFHDRFKAGQSISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLMGRHLQQEYGQ
FT                   EPQCILTMPLLEGLDGIEKMSKSKNNYIGISEDANSMFAKVLSISDVLMWKWYTLLSFK
FT                   SEADIAALKAEIEAGRNPKDAKVALAKEITARFHSAAAADAAEQDFINRSKGGVPDEIP
FT                   DVSLSGAPLGIGALLKAAGLAPSGSEASRLIDGGGVRVDSSVVSDKALKLAAGTYVVQV
FT                   GKRKFARVTLA"
     atgaatcaag agcttgttac aaattcaccc ctgtctgacc gtgtaaagac ggcgctggcc        60
     gtctccctgc ggggctgcga cgagctgatt ccgcaggacg aatggacccg caaactggtc       120
     cgcagcgaag ccaccggcgt gccgctgcgc atcaagctgg ggctggaccc gaccgcgccc       180
     gacatccaca tcggccacac cgtggtgctc aacaagatgc gccagttgca ggacctgggc       240
     cacacggtga tcttcctgat tggcgacttc accagcctga ttggcgatcc gtcggggcgc       300
     aacagcacgc gcccgccgct cacgcccgag cagatcaagg tgaacgccga aacctattac       360
     cgccaggcca gcctggtgct ggacccggcc aaaaccgaga ttcgctacaa cagcgaatgg       420
     tgcgacccgc tgggcgcgcg cggcatgatc cagctcgctt cgcgctacac cgtggcgcgc       480
     atgatggagc gcaacgactt tcacgaccgc ttcaaggccg gccagtcgat cagcgtgcat       540
     gaattcttgt acccgctgat gcagggctat gactcggtgg cgctcaagag cgacctggaa       600
     ctcggcggca ccgaccagaa gttcaatttg ctgatgggcc ggcatctgca gcaggaatac       660
     ggccaggagc cgcagtgcat cctgaccatg ccgctgctcg aaggcctgga cggcatcgag       720
     aagatgtcga aaagcaagaa caactacatt ggcatttccg aggacgccaa ttccatgttc       780
     gccaaggtgc tgtcgatctc cgatgtgctg atgtggaagt ggtacacgct gctgtcgttc       840
     aaaagcgaag ccgacatcgc cgcgctgaag gccgaaattg aagccggccg caaccccaag       900
     gacgccaagg tcgcgctggc caaggaaatc accgcgcgct ttcattccgc cgcagcagcg       960
     gacgccgccg agcaggattt catcaaccgc agcaagggcg gcgtgcccga cgagattccc      1020
     gacgtgtcgc tgtcgggcgc gccgctgggc ataggcgcgc tgctcaaggc ggccgggctg      1080
     gcgccttcgg gcagcgaagc cagccgcctg atcgacggcg gcggcgtgcg cgtggactcc      1140
     agcgtggtca gcgacaaggc gctcaagctg gcggccggga cttacgtggt gcaggtcggc      1200
     aagcgcaagt ttgcccgcgt gacgctggca tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page