(data stored in ACNUC7421 zone)

EMBL: CP000529.PE506

CP000529.PE506       Location/Qualifiers
FT   CDS_pept        540753..541823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0512"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: pol:Bpro_4093 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35833"
FT                   /db_xref="GOA:A1VJK5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK5"
FT                   /protein_id="ABM35833.1"
FT                   /translation="MTIQTDDFDMSDLPPARRMLSAAPASPKEEAIERALRPKLFDDYV
FT                   GQTKAREQLEIFIGAANKRQEALDHVLLFGPPGLGKTTLSHIIAHELGVNMRSTSGPVL
FT                   EKPKDLAALLTNLEKNDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSIKL
FT                   DLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPEELARIVKRSAGLLNAPMDAEGG
FT                   FEIARRSRGTPRIANRLLRRVRDYADVKGNGTITLDIANRALAMLDVDPQGFDLMDRKF
FT                   LEAVILRFDGGPVGLDNIAASIGEESGTIEDVIEPYLIQQGFLQRTPRGRIATLAAYRH
FT                   LGVAPPRGNAENLFEE"
     atgaccatcc agaccgacga cttcgacatg tccgacctgc cgccggcccg gcgtatgctg        60
     tcggccgccc cggcctcgcc gaaagaagag gccatcgagc gtgccctgcg gcccaagctg       120
     ttcgacgact atgtcggcca gaccaaggcg cgcgagcagc ttgaaatctt catcggcgcg       180
     gccaacaagc gccaggaagc gctcgaccat gtgctgctgt tcggcccgcc cggcctgggc       240
     aagaccacgc tgagccacat catcgcgcac gaactcggcg tgaacatgcg ctcgacctcg       300
     gggccggtgc tggaaaagcc caaggatctg gcggcgctgc tgaccaacct cgaaaagaac       360
     gatgtcctgt tcatcgacga aatccaccgc ctgagcccgg tggtcgagga aatcctgtat       420
     ccggcgctgg aagattatca aatcgacatc atgatcggcg aaggcccggc ggcgcgctcc       480
     atcaagcttg acttgcagcc gttcacgctg gtcggcgcca cgacccgcgc cggcatgctg       540
     accaatccgc tgcgcgaccg cttcggcatc gtcgcccggc tggagttcta cacacccgag       600
     gagctggcgc gcatcgtcaa gcgcagcgcc ggcctgctga atgcgccgat ggacgcggaa       660
     ggcggcttcg agatcgcgcg ccgttcgcgc ggaacgccgc gcatcgccaa ccggctgctg       720
     cgccgggtgc gcgactatgc cgatgtcaag ggcaacggca ccatcacgct ggacatcgcc       780
     aaccgggcgc tggccatgct ggacgtcgat ccgcagggct ttgacctgat ggaccgcaag       840
     ttcttggagg ccgtgatttt gcgtttcgac ggcggcccgg tcgggctgga caacattgcc       900
     gccagcatcg gcgaggagtc cgggacgatt gaagacgtga tcgagccgta tttgattcag       960
     cagggttttt tgcagcgcac gccgcgcggg cgcattgcca cgctggcggc gtaccggcac      1020
     ctgggcgtgg cgccgccgcg cggcaatgcc gagaatctgt ttgaagagta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page