(data stored in ACNUC7421 zone)

EMBL: CP000529.PE51

CP000529.PE51        Location/Qualifiers
FT   CDS_pept        52320..52619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35378"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA0"
FT                   /protein_id="ABM35378.1"
FT                   /translation="MQAHYAETFERDMGCTEAEWLGWLPAALGDHAWQRSGPSVQARIG
FT                   PGSLQIDWRPAAPRVLGSARIPRLLVRFAFAGLDDGQRHAFMKRFDVYMQRGGG"
     gtgcaggcgc attacgccga gactttcgag cgcgacatgg gctgcaccga agccgaatgg        60
     ctgggctggc tgcccgccgc gctgggcgac cacgcctggc agcgcagcgg gccatccgtg       120
     caggcccgca tcggcccggg cagcctgcaa atcgactggc ggccggcagc gccccgcgtg       180
     ctcggcagcg cccggattcc gcgcctgctg gtgcgctttg cctttgccgg actcgatgac       240
     ggccagcgcc acgccttcat gaagcgcttc gatgtgtaca tgcagcgcgg cggcggctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page