(data stored in ACNUC7421 zone)

EMBL: CP000529.PE517

CP000529.PE517       Location/Qualifiers
FT   CDS_pept        549995..551251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0523"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: rfr:Rfer_1097 extracellular solute-binding
FT                   protein, family 1; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35844"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL6"
FT                   /protein_id="ABM35844.1"
FT                   /translation="MLKFSKLAAAAAFVAVAAAAMAGEVEVLHYWTSGGEAKSVDELKT
FT                   MMAGRGYTWKDFAVTGGGGENAMGMLKKRVLAGNPPAAALIKGPTIQEWANLNVLTNLD
FT                   TMAQFGKWDESLPKVIAEQMKYQGHYVAVPVNVHRVNWLWANSAVLKKAGVTALPKTYE
FT                   EFFAAADKLRAAGFIPLAHGGQDWQDFTVFESVALGVGGTAFYNKALVRLDEAALAGSE
FT                   MRKTLEVFRRLKPYTDDKSAGRDWNQATALVTAGKAGFQLMGDWAKGEFLAANQEPGKD
FT                   FTCTPAPGTAHAYSFNVDSFAMFQLKNGDARKAQGYLAFLLMGQNFQERFNLRKGSIPA
FT                   RLNMNLDKFDECARLSGQDFAAMSKTGALVPSVAHGMAVPPAVQSALRAAVSDFWNNDK
FT                   TTVNETLARLALAAGAPVK"
     atgctgaaat tttccaaact ggccgctgct gcggcttttg tggcggtggc tgcggcggct        60
     atggcgggcg aagtcgaagt gctgcattac tggacctccg gcggcgaggc caagtcggtt       120
     gacgaactca agaccatgat ggcgggccgt ggctatacct ggaaagactt cgccgtgaca       180
     ggcggtggtg gcgaaaacgc catgggcatg ctgaaaaagc gcgtgctggc gggcaatcca       240
     ccggcggcgg ccttgatcaa aggccccact attcaggaat gggccaatct caatgtgctg       300
     accaacctcg acaccatggc gcagtttggc aagtgggacg agtcgctgcc caaagtgatt       360
     gccgagcaga tgaagtacca gggccactat gtggcagtcc ccgtcaatgt tcaccgcgtg       420
     aactggctgt gggccaattc ggccgtgctg aaaaaggccg gggtcactgc cttgccaaaa       480
     acatacgagg agttttttgc cgccgccgac aagctgcggg ccgcagggtt tattcccctg       540
     gcgcacggcg ggcaggactg gcaggacttc acggtgttcg agtcggtggc tctgggcgtg       600
     ggcggtacgg cgttttacaa caaggcgctg gtcaggctcg atgaggccgc ccttgctggc       660
     agcgagatgc gtaaaaccct ggaggtgttt cgccggctca agccctatac cgatgacaag       720
     tccgccggac gcgactggaa ccaggccacc gccctggtga ctgccggaaa agccggtttt       780
     cagctaatgg gggactgggc caagggcgaa tttctggcgg ccaatcaaga gccgggcaag       840
     gactttacct gtacgccagc gcccggcact gcccatgcct acagcttcaa tgtcgattca       900
     tttgccatgt tccagctcaa aaacggggat gcgcgcaagg cgcagggcta tttggctttt       960
     ttgctgatgg ggcagaactt tcaggagagg ttcaacctgc gcaagggctc gattccggcc      1020
     aggctgaaca tgaatctgga caagtttgac gaatgcgcca ggttgtccgg ccaggatttt      1080
     gcggcgatgt ccaaaaccgg cgcgctggtg ccttccgtgg cgcatggcat ggccgtgccg      1140
     cctgcggtgc agtcggctct gcgcgccgct gtgagtgatt tctggaataa cgataaaacc      1200
     accgtgaacg agaccctggc caggttggcg ctggcggccg gcgccccagt gaagtaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page