(data stored in ACNUC7421 zone)

EMBL: CP000529.PE519

CP000529.PE519       Location/Qualifiers
FT   CDS_pept        complement(552677..554497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0525"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   pol:Bpro_3916 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35846"
FT                   /db_xref="GOA:A1VJL8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL8"
FT                   /protein_id="ABM35846.1"
FT                   /translation="MSAAVLAPNFAPPAPPSLSLGVIGNCAFSALVDARGRIVWCCLPR
FT                   FDGDPVFNALLDESDKGSAFAIEIENFSHSKQWYDPNTAVLRTQLFDKSGQAIEITDFA
FT                   PRFYNRSRFFKPMTLVRRVRPIKGAPRIRVQLDVRFDWGRSEPVITQGSNHLRYVGDAL
FT                   TLRLNTDAPLSHLLAKRPFVLTREYNFLLGSDESLADGIADTARLFEQETLSYWRKWSQ
FT                   RLHIPLEWQEAVIRAAITLKLSLFEDTGAIVAAMTTSIPEAPNSGRTWDYRFCWLRDAF
FT                   FVVRALNSLSEVGTMEDYLRWLGNVVVQADGGHIQPLFGIGLELELPEAVYDHLGGYRG
FT                   MGPVRVGNQAQEHFQHDVYGNVILGAAQAFHDHRLLHRAGAAEFLRLEAVGEQAVRSYD
FT                   KPDAGMWELRTRARVHTSSALMCWAACDRLGKIAVTLKQPERASYWSHHAQIMRERILR
FT                   ESWSEERQAFAESFGGRDLDASVLLMIEVGFIEPKDPRFVATVDALEKYLCDGPYMRRY
FT                   EAPDDFGKPETAFNICTFWRIDALARIGRKDEARAIFETMLAARNHVGLLSEDTHPVTG
FT                   EMWGNFPQTYSMVGIINAAVRLSAPWDSLV"
     atgagcgccg ccgtcctggc gcccaacttt gcgccgcccg caccgccgtc gctgtcgctg        60
     ggcgtgatcg gcaactgcgc gttcagcgcg ctggtcgatg cgcgcggacg catcgtctgg       120
     tgctgcctgc cgcgcttcga tggcgacccg gtgttcaatg cgctgctcga cgagagcgac       180
     aagggcagcg cctttgccat cgaaatcgag aacttttccc attcaaagca atggtacgac       240
     ccgaacaccg ccgtgctgcg cacccaactg ttcgacaaaa gcggccaggc gattgaaatc       300
     accgactttg cgccgcgctt ttacaaccgc tcgcggtttt tcaagccgat gacgctggtg       360
     cgccgggtgc gcccgatcaa gggcgcgccg cgcatccggg tgcagctcga cgtgcgcttc       420
     gactggggcc gcagcgagcc agtgatcacc cagggcagca accacctgcg ctatgtcggc       480
     gatgcgctga cgctgcgcct gaacaccgac gcgccgctgt cgcacctgct ggccaagcgg       540
     cctttcgtgc tgacgcgcga atacaatttt ttgctcggct ccgacgagtc gctggccgac       600
     ggcattgccg acaccgcgcg cctgttcgag caggaaacgc tgtcgtactg gcgcaagtgg       660
     agccagcgcc tgcacatccc gctcgaatgg caggaagccg tgatccgggc cgcgatcaca       720
     ctcaagctct cgctgttcga ggacaccggc gcgattgtcg cggccatgac caccagcatt       780
     cccgaagcgc ccaacagcgg acgcacctgg gactaccgct tttgctggct gcgcgatgcc       840
     ttttttgtcg ttcgggcgct caacagcctg tccgaagtcg gcaccatgga agactacctg       900
     cgctggctcg gcaatgtcgt ggtgcaggcc gacggcgggc atatccagcc gctgttcggc       960
     attggcctgg agctggagct gcccgaagcg gtgtacgacc acctgggcgg ctaccggggc      1020
     atggggccgg tgcgcgtggg caaccaggcg caggagcatt tccagcacga tgtctatggc      1080
     aatgtgatcc tgggtgcggc ccaggccttt cacgaccacc ggctgctgca ccgggcaggc      1140
     gcggccgaat tcttgcgcct cgaagcggtg ggcgagcagg cggtgcgcag ctacgacaaa      1200
     cccgatgccg gcatgtggga gttgcgcacg cgcgcccggg tgcatacctc gtcggcgctg      1260
     atgtgctggg cggcctgcga ccggctgggc aagattgccg tcacgctcaa gcagcccgag      1320
     cgcgccagct actggagcca tcatgcgcag atcatgcgcg agcgcatcct gcgcgaatcg      1380
     tggagcgagg agcgccaggc ctttgccgag agctttggcg ggcgcgacct ggacgccagc      1440
     gtgctcctga tgatcgaagt cggcttcatc gagccgaaag acccgcgctt cgtggccacc      1500
     gtcgatgcgc tggaaaaata tttgtgcgac ggcccctaca tgcgccgcta cgaggcgccc      1560
     gacgactttg gcaagcccga aaccgccttc aacatctgca ccttctggcg catcgacgcg      1620
     ctggcgcgca tcggccgcaa ggatgaggcc cgggcgattt tcgagaccat gctggccgcc      1680
     cgcaaccacg tcggcctgct gtccgaggac acccatccgg tgaccggcga gatgtggggc      1740
     aatttcccgc aaacctattc gatggtcggc atcatcaacg ccgccgtgcg cctgtcggcc      1800
     ccttgggatt ccctagtatg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page