(data stored in ACNUC7421 zone)

EMBL: CP000529.PE53

CP000529.PE53        Location/Qualifiers
FT   CDS_pept        54110..55105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP1772 cell wall surface anchor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35380"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA2"
FT                   /protein_id="ABM35380.1"
FT                   /translation="MRHVLTLAAASAMLVACGGGSDSAPAATPTPAATQATLTSANYVA
FT                   VAQESLSSSAYLANTTGLVTGAQVSDSEALIRFGQDQLPKLPRWLADAPVQAVGAVQSQ
FT                   TENCAGGGTLTISANDANGNRLVDAGDSVSLTANNCSFEGQLLNGQLTLTINSLTGNPD
FT                   HYPYSLSVTLGFNNLATQSASLRTVGNGSLALSIDARAANDQSLVLRTSSLNLSSTYGT
FT                   TTYSKTLTGYATSVELRPAGTGFTSTTSVDGTLSSSAFESRSISIATPVSFVRTSGQTY
FT                   PSSGQLVITGAAGGKIRVTVTSATTVLIELDADANGSYEASTSKLWSDML"
     atgcgccatg tcctgaccct tgctgctgcc tctgccatgc ttgttgcctg cggtggtggc        60
     agcgactcgg cccctgcggc cacgcccact ccggctgcaa cgcaagccac cctgacttct       120
     gccaactacg tggcggtcgc ccaggaatcg ctgtcgtctt ctgcttacct cgccaacaca       180
     actggccttg tcacaggcgc tcaagtcagc gattccgagg cactgatccg ttttggccag       240
     gaccagcttc ccaagctgcc gcgctggctg gccgatgcgc ccgtgcaggc ggttggcgcc       300
     gtgcagagcc agactgaaaa ctgcgcgggc ggcggcacgc tgaccatttc agcgaacgac       360
     gccaacggca atcgcctggt ggatgcaggc gattcggtct ccctgacggc aaacaactgc       420
     tcgttcgaag gccagttgtt gaacggtcaa ttgaccctga ccatcaacag cttgaccggc       480
     aatcctgacc attaccccta cagtttgtcg gtcaccctcg gcttcaacaa tctggcgacg       540
     caatccgcgt cattgcgcac cgttggaaac ggcagccttg ccttgtccat cgatgcacgc       600
     gccgccaacg accagtcgct ggtgctgcgc acttccagcc tgaacctttc atcgacttac       660
     ggcaccacca cttacagcaa aacgctaacc ggctatgcga cttccgtgga gttgcgcccc       720
     gcaggcaccg gtttcacctc caccacctcg gtggacggaa cgctgagcag ctcggccttc       780
     gagtccagaa gcatcagcat cgccacgccg gtttctttcg tcaggacaag cgggcagact       840
     taccccagca gcggccagct cgtcatcacc ggcgcggcag gcggcaagat ccgagtcact       900
     gtcaccagcg ccaccacggt gctgatcgag ctggatgcgg acgccaacgg cagctacgaa       960
     gcgtccacga gcaagctctg gagcgacatg ctttga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page